DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf13 and rnf13

DIOPT Version :9

Sequence 1:NP_001106884.1 Gene:Rnf13 / 24017 MGIID:1346341 Length:381 Species:Mus musculus
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:359 Identity:272/359 - (75%)
Similarity:323/359 - (89%) Gaps:2/359 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    25 AFLNLLPVEADILAYNFENASQTFEDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPP-LKDN 88
            |.::|:||:||:.||..:|.|:||:|||||||||||::||||:::.:||||||:||.||| |:||
 Frog    25 AVIHLVPVQADVAAYTADNVSRTFDDLPARFGYRLPSDGLKGYIVTAKPENACQPISPPPLLRDN 89

Mouse    89 SSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIDTLKKIDIPSVFIGES 153
            :|..|||||:||:||||:||||||:||:|||:|:||||||||||||||:|.||:|||||||||||
 Frog    90 TSSVFIVLIKRLECNFDLKVLNAQKAGFKAAVVYNVDSDDLISMGSNDVDILKQIDIPSVFIGES 154

Mouse   154 SANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRNRRNRL 218
            ||..||:||::||||:|:|||:|:||||||||||||||||||:||||||||||||||||.|||||
 Frog   155 SARFLKEEFSWEKGGYIVLVPDLTLPLEYYLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRL 219

Mouse   219 RKDQLKKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 283
            |||||||||:|||||||||||||:||:|||:||||||||||||||||||||||||||||||||||
 Frog   220 RKDQLKKLPIHKFKKGDEYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 284

Mouse   284 KVVPSQGDSDSDTDSSQEENQVSEHTPLLPPSASARTQSFGSLSESHSHHNMTESS-DYEDDDNE 347
            |||||||||:||:|||||:|:|||:||||.|.|||.|||||::|||||..||.||| :.||||::
 Frog   285 KVVPSQGDSESDSDSSQEDNEVSENTPLLRPMASASTQSFGAISESHSQQNMMESSGEDEDDDDD 349

Mouse   348 ETDSSDADNEITDHSVVVQLQPNGEQDYNIANTV 381
            |.||..:|.|....|||||||.|.|::....|||
 Frog   350 EDDSDSSDEEHNTESVVVQLQHNMERESRERNTV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf13NP_001106884.1 PA_C_RZF_like 23..180 CDD:239038 109/155 (70%)
RING-H2_RNF167 238..283 CDD:319711 41/44 (93%)
RING-H2 finger (C3H2C3-type) 240..281 CDD:319711 37/40 (93%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381 61/96 (64%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038 109/155 (70%)
RING_Ubox 239..284 CDD:388418 41/44 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I20549
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13493
Inparanoid 1 1.050 570 1.000 Inparanoid score I6679
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - oto194649
Panther 1 1.100 - - LDO PTHR22765
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.160

Return to query results.
Submit another query.