DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pebp1 and a5

DIOPT Version :9

Sequence 1:NP_061346.2 Gene:Pebp1 / 23980 MGIID:1344408 Length:187 Species:Mus musculus
Sequence 2:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster


Alignment Length:171 Identity:73/171 - (42%)
Similarity:107/171 - (62%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    17 VDEPPQHALRVDYAGVTVD-ELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPK 80
            :||||:..||:.|.. |:| |.||..|||::..:| .:.|:. ||...||:::..||||:|::|.
  Fly    40 LDEPPRELLRIKYDN-TIDIEEGKTYTPTELKFQP-RLDWNA-DPESFYTVLMICPDAPNRENPM 101

Mouse    81 FREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDN 145
            :|.|.|:||||:.|.||..|..:|:|.|..||..:|:.||:.|||:|...|..||..:...:.|.
  Fly   102 YRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADG 166

Mouse   146 RGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSG 186
            ...|.|..|.:||.:|:||||..:|:.||:|||:|.:.|.|
  Fly   167 HSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTLYG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pebp1NP_061346.2 PEBP_euk 25..171 CDD:176644 60/146 (41%)
Interaction with RAF1. /evidence=ECO:0000250 93..134 17/40 (43%)
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 60/147 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.