DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osr1 and sr

DIOPT Version :9

Sequence 1:NP_035989.1 Gene:Osr1 / 23967 MGIID:1344424 Length:266 Species:Mus musculus
Sequence 2:NP_001262693.1 Gene:sr / 42162 FlyBaseID:FBgn0003499 Length:1271 Species:Drosophila melanogaster


Alignment Length:306 Identity:76/306 - (24%)
Similarity:111/306 - (36%) Gaps:102/306 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 SFLQAVNGLPTVPSDHLPNLYGFSALHAVH--------------LHQWTLGYPAMHLPRSSFSKV 72
            |:..|..|.|           |...||:.|              .:|| |..||      .:::.
  Fly   862 SYAGASAGFP-----------GLGDLHSSHEQQLQQQQYVRSQPKYQW-LDSPA------DYAQQ 908

Mouse    73 PGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFANLALAATQED-----PT 132
            ...|..:...:.|...      ::.|.|..:|..|.|||.          .|...||:     |:
  Fly   909 QQQVQQVQQQQQQQQT------LVLPGPTSSASSSNAALG----------VLIPKQENYPDMQPS 957

Mouse   133 KLGRGEGPGSPAGGLGAL--------------------------------------LDVTKLSPE 159
            ..|.|...||  ||..|.                                      |.:..:.|.
  Fly   958 SNGTGYSGGS--GGSSAAAAAAAAAAAAAVQLAEYSPSTSKGHEILSQVYQQSTVPLKLVPVKPR 1020

Mouse   160 KKPTRGRLPSKT---KKEFVC--KFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLR 219
            |.|.|   ||||   ::.:.|  :.|.|.|::|..|..|.|.||.::|:.|.||.::|.|.|||.
  Fly  1021 KYPNR---PSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLT 1082

Mouse   220 DHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIK 265
            .|...|:.||||.|..||:.|.:|.....|..:|.: :.:|..|::
  Fly  1083 THIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK-QRIKKEKVR 1127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osr1NP_035989.1 zf-C2H2 175..197 CDD:395048 8/23 (35%)
C2H2 Zn finger 177..197 CDD:275368 8/21 (38%)
zf-H2C2_2 189..214 CDD:404364 10/24 (42%)
C2H2 Zn finger 205..225 CDD:275368 9/19 (47%)
zf-H2C2_2 217..240 CDD:404364 11/22 (50%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
srNP_001262693.1 zf-C2H2 1036..1060 CDD:278523 8/23 (35%)
C2H2 Zn finger 1038..1060 CDD:275368 8/21 (38%)
zf-H2C2_2 1052..1077 CDD:290200 10/24 (42%)
C2H2 Zn finger 1068..1088 CDD:275368 9/19 (47%)
zf-H2C2_2 1080..1105 CDD:290200 12/24 (50%)
C2H2 Zn finger 1096..1116 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.