| Sequence 1: | NP_035989.1 | Gene: | Osr1 / 23967 | MGIID: | 1344424 | Length: | 266 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
| Alignment Length: | 256 | Identity: | 73/256 - (28%) |
|---|---|---|---|
| Similarity: | 99/256 - (38%) | Gaps: | 65/256 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 59 YPAMHLPRSSFSKVPGAVS--SLMDARFQLPAF-----------PWFPHVIHPKPEITAGGSGAA 110
Mouse 111 LKTKPRFDFANLALAATQEDP--TKLGRGEGP-GSP------------AGGLGALLDV-TKLS-- 157
Mouse 158 ----------PEKKPTRGRLPSKT-------------------KKEFVCKFCGRHFTKSYNLLIH 193
Mouse 194 ERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHS 254 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Osr1 | NP_035989.1 | zf-C2H2 | 175..197 | CDD:395048 | 10/21 (48%) |
| C2H2 Zn finger | 177..197 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 189..214 | CDD:404364 | 14/24 (58%) | ||
| C2H2 Zn finger | 205..225 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 217..240 | CDD:404364 | 9/22 (41%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
| Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 9/19 (47%) |
| zf-H2C2_2 | 237..261 | CDD:290200 | 14/23 (61%) | ||
| C2H2 Zn finger | 252..272 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 264..289 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 280..300 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 292..316 | CDD:290200 | 3/10 (30%) | ||
| C2H2 Zn finger | 308..328 | CDD:275368 | |||
| zf-H2C2_2 | 321..345 | CDD:290200 | |||
| C2H2 Zn finger | 336..352 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||