DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Osr1 and cbt

DIOPT Version :9

Sequence 1:	NP_035989.1	Gene:	Osr1 / 23967	MGIID:	1344424	Length:	266	Species:	Mus musculus
Sequence 2:	NP_722636.1	Gene:	cbt / 33224	FlyBaseID:	FBgn0043364	Length:	428	Species:	Drosophila melanogaster

Alignment Length:	143	Identity:	47/143 - (32%)
Similarity:	70/143 - (48%)	Gaps:	23/143 - (16%)

- Green bases have known domain annotations that are detailed below.

Mouse   122 LALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTR---GRLPSKTKKEFVCKF--CG 181
            |:..|.|:.||.:     |.:|.           :|.||..||   .:..:...:.:.|.|  ||
  Fly   223 LSTVAAQQSPTPV-----PKTPT-----------MSEEKLTTRITAAQAAATRSRIYECSFPDCG 271

Mouse   182 RHFTKSYNLLIHERTHTDERPYTC--DICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSR 244
            :::.||.:|..|:|.||.|||:.|  :.|.|.|.|.|.|..|:..|:.||.|:|..|.|.|.:|.
  Fly   272 KNYFKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSD 336

Mouse   245 TLAVHKTLHSQVK 257
            .|:.|...|::.|
  Fly   337 HLSKHVKRHNKDK 349

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Osr1	NP_035989.1	zf-C2H2	175..197	CDD:395048	9/23 (39%)
		C2H2 Zn finger	177..197	CDD:275368	9/21 (43%)
		zf-H2C2_2	189..214	CDD:404364	12/26 (46%)
		C2H2 Zn finger	205..225	CDD:275368	8/21 (38%)
		zf-H2C2_2	217..240	CDD:404364	9/22 (41%)
		C2H2 Zn finger	233..253	CDD:275368	7/19 (37%)
cbt	NP_722636.1	zf-C2H2	263..287	CDD:278523	9/23 (39%)
		C2H2 Zn finger	265..287	CDD:275368	9/21 (43%)
		COG5048	<270..362	CDD:227381	33/80 (41%)
		zf-H2C2_2	279..306	CDD:290200	12/26 (46%)
		C2H2 Zn finger	295..317	CDD:275368	8/21 (38%)
		zf-H2C2_2	309..332	CDD:290200	9/22 (41%)
		zf-C2H2	323..345	CDD:278523	8/21 (38%)
		C2H2 Zn finger	325..345	CDD:275368	7/19 (37%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030