Sequence 1: | NP_035984.2 | Gene: | Oasl2 / 23962 | MGIID: | 1344390 | Length: | 508 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001284937.1 | Gene: | Ubi-p5E / 326237 | FlyBaseID: | FBgn0086558 | Length: | 534 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 58/266 - (21%) |
---|---|---|---|
Similarity: | 101/266 - (37%) | Gaps: | 71/266 - (26%) |
- Green bases have known domain annotations that are detailed below.
Mouse 284 YNFQNEVVRNFLKKQLKGDRPII------------LDPADPTNNL-------------------- 316
Mouse 317 ------GRRKGWEQVAAEAAFCLLQVCCTTVGPSERWNVQRAR-DVQVRVKQTGTVDWTLWTNPY 374
Mouse 375 SPIRKMKAEIRREKNFGGELRISFQEPGGERQL------LSSRKTLADYGIFSKVNIQVLETFPP 433
Mouse 434 EILVFVKYPGGQSKPFTIDPDDTILDLKEKIEDAGGPCAEDQVLLLDDEELEDDESLKELEIKDC 498
Mouse 499 DTIILI 504 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Oasl2 | NP_035984.2 | NT_2-5OAS_ClassI-CCAase | 29..214 | CDD:143390 | |
OAS1_C | 170..352 | CDD:371041 | 16/105 (15%) | ||
Ubl1_OASL | 355..428 | CDD:340509 | 18/78 (23%) | ||
Ubiquitin_like_fold | 434..505 | CDD:391949 | 22/71 (31%) | ||
Ubi-p5E | NP_001284937.1 | Ubiquitin | 1..76 | CDD:176398 | 6/17 (35%) |
UBQ | 1..72 | CDD:214563 | 5/13 (38%) | ||
Ubiquitin | 77..152 | CDD:176398 | 11/89 (12%) | ||
UBQ | 77..148 | CDD:214563 | 9/85 (11%) | ||
Ubiquitin | 153..228 | CDD:176398 | 18/84 (21%) | ||
UBQ | 153..224 | CDD:214563 | 18/80 (23%) | ||
Ubiquitin | 229..304 | CDD:176398 | 22/70 (31%) | ||
UBQ | 229..300 | CDD:214563 | 22/70 (31%) | ||
Ubiquitin | 305..380 | CDD:176398 | |||
UBQ | 305..376 | CDD:214563 | |||
Ubiquitin | 381..456 | CDD:176398 | |||
UBQ | 381..452 | CDD:214563 | |||
Ubiquitin | 457..532 | CDD:176398 | |||
UBQ | 457..528 | CDD:214563 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |