DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oasl2 and Ubi-p5E

DIOPT Version :9

Sequence 1:NP_035984.2 Gene:Oasl2 / 23962 MGIID:1344390 Length:508 Species:Mus musculus
Sequence 2:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster


Alignment Length:266 Identity:58/266 - (21%)
Similarity:101/266 - (37%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse   284 YNFQNEVVRNFLKKQLKGDRPII------------LDPADPTNNL-------------------- 316
            ||.|.|...: |..:|:|...|.            ::|:|...|:                    
  Fly    59 YNIQKESTLH-LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA 122

Mouse   317 ------GRRKGWEQVAAEAAFCLLQVCCTTVGPSERWNVQRAR-DVQVRVKQTGTVDWTLWTNPY 374
                  ||......:..|:...|               |.|.| .:|:.||.......||...|.
  Fly   123 GKQLEDGRTLSDYNIQKESTLHL---------------VLRLRGG
MQIFVKTLTGKTITLEVEPS 172

Mouse   375 SPIRKMKAEIRREKNFGGELRISFQEPGGERQL------LSSRKTLADYGIFSKVNIQVLETFPP 433
            ..|..:||:|:.::..          |..:::|      |...:||:||.|..:..:.::.....
  Fly   173 DTIENVKAKIQDKEGI----------PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG 227

Mouse   434 EILVFVKYPGGQSKPFTIDPDDTILDLKEKIEDAGGPCAEDQVLLLDDEELEDDESLKELEIKDC 498
            .:.:|||...|::....::|.|||.::|.||:|..|...:.|.|:...::|||..:|.:..|:..
  Fly   228 GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 292

Mouse   499 DTIILI 504
            .|:.|:
  Fly   293 STLHLV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oasl2NP_035984.2 NT_2-5OAS_ClassI-CCAase 29..214 CDD:143390
OAS1_C 170..352 CDD:371041 16/105 (15%)
Ubl1_OASL 355..428 CDD:340509 18/78 (23%)
Ubiquitin_like_fold 434..505 CDD:391949 22/71 (31%)
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 6/17 (35%)
UBQ 1..72 CDD:214563 5/13 (38%)
Ubiquitin 77..152 CDD:176398 11/89 (12%)
UBQ 77..148 CDD:214563 9/85 (11%)
Ubiquitin 153..228 CDD:176398 18/84 (21%)
UBQ 153..224 CDD:214563 18/80 (23%)
Ubiquitin 229..304 CDD:176398 22/70 (31%)
UBQ 229..300 CDD:214563 22/70 (31%)
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.