DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and YFH1

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_010163.1 Gene:YFH1 / 851437 SGDID:S000002278 Length:174 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:43/101 - (42%)
Similarity:62/101 - (61%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    95 YERLAEETLDSLAEFFEDLAD-KPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSS 158
            |...|::.||.|.:..|:|:: .|....|.::|  .||:|:::.. .||||||||.|||||||:|
Yeast    73 YHEEADDYLDHLLDSLEELSEAHPDCIPDVELS--HGVMTLEIPA-FGTYVINKQPPNKQIWLAS 134

Human   159 PSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKAL 194
            |.|||.|:|.....||...:|..|.::|..|:.||:
Yeast   135 PLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 41/97 (42%)
YFH1NP_010163.1 mito_frataxin 72..168 CDD:132463 41/97 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C159048330
Domainoid 1 1.000 79 1.000 Domainoid score I2269
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1580
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto145540
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.