DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and Fxn

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_001382061.1 Gene:Fxn / 499335 RGDID:1565754 Length:208 Species:Rattus norvegicus


Alignment Length:208 Identity:153/208 - (73%)
Similarity:167/208 - (80%) Gaps:2/208 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQI 65
            |||.||||.||||.. :.::|....|.||..|....||||||....:|... |.:..|...|.||
  Rat     1 MWTFGRRAAAGLLPR-TASRASAWVRNPRGRERIGTCGRRGLHVTANADAI-RHSHLNLHYLGQI 63

Human    66 WNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSG 130
            .|:|||||.:::||.|||||:|.|||||.||||||||||:||||||||||||||.:|||||||.|
  Rat    64 LNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDG 128

Human   131 VLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALK 195
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||.|||:||.
  Rat   129 VLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALN 193

Human   196 TKLDLSSLAYSGK 208
            |||||||||||||
  Rat   194 TKLDLSSLAYSGK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 90/97 (93%)
FxnNP_001382061.1 mito_frataxin 92..190 CDD:132463 90/97 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83685445
Domainoid 1 1.000 196 1.000 Domainoid score I24794
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47908
Inparanoid 1 1.050 284 1.000 Inparanoid score I14814
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG37510
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto139422
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1616.410

Return to query results.
Submit another query.