DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and fh

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster


Alignment Length:185 Identity:77/185 - (41%)
Similarity:105/185 - (56%) Gaps:17/185 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    38 GRRGLRTDIDATC--TPRRASSNQRGLNQIWNVKKQSV---------YLMNLRK-SGTLGHPGSL 90
            ||..:|:.:...|  |..|.|..|...:|:......::         :..|.|. |..:....:|
  Fly     4 GRLMVRSIVGRACLATMGRWSKPQAHASQVILPSTPAIAAVAIQCEEFTANRRLFSSQIETESTL 68

Human    91 DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIW 155
            |..||||:..:|||:|.::||:|.:.....:..||::..|||||.|||..||||||:||||||||
  Fly    69 DGATYERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGGQHGTYVINRQTPNKQIW 133

Human   156 LSSPSSGPKRYDWTGK----NWVYSHDGVSLHELLAAELTKALKTK-LDLSSLAY 205
            ||||:|||||||:.|.    .|:|.|.|.||||||..|:...||:: :|...|.|
  Fly   134 LSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEIPGILKSQSVDFLRLPY 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 58/101 (57%)
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 58/100 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148090
Domainoid 1 1.000 128 1.000 Domainoid score I5341
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4617
Isobase 1 0.950 - 0 Normalized mean entropy S1580
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto91437
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.