DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and SPCC1183.03c

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_587886.1 Gene:SPCC1183.03c / 2539143 PomBaseID:SPCC1183.03c Length:158 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:52/123 - (42%)
Similarity:80/123 - (65%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    72 SVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKL 136
            :|:.:..|....:.|.|:|.:..|.|:|::|||.|.:.||||.:: ...:|||:.:.:||:|:.|
pombe    24 NVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEE-VGKKDYDIQYANGVITLML 87

Human   137 GGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWT--GKNWVYSHDGVSLHELLAAELTK 192
             |:.||||||||.|..|||||||.||||.|:::  .|.|..:.|..:|..:|::|.:|
pombe    88 -GEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSSEFSK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 46/99 (46%)
SPCC1183.03cNP_587886.1 mito_frataxin 46..144 CDD:132463 46/99 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2341
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1909
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto147113
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.