DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and Fxn

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_032070.1 Gene:Fxn / 14297 MGIID:1096879 Length:207 Species:Mus musculus


Alignment Length:208 Identity:152/208 - (73%)
Similarity:163/208 - (78%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQI 65
            ||..|.||..|||.. :.::|......||..|....||||||...::|..| |.|..|...| ||
Mouse     1 MWAFGGRAAVGLLPR-TASRASAWVGNPRWREPIVTCGRRGLHVTVNAGAT-RHAHLNLHYL-QI 62

Human    66 WNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSG 130
            .|:|||||.:::||..|||.:|.|||||.|||||||||||||||||||||||||.||||||||.|
Mouse    63 LNIKKQSVCVVHLRNLGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDG 127

Human   131 VLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALK 195
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||.
Mouse   128 VLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALN 192

Human   196 TKLDLSSLAYSGK 208
            |||||||||||||
Mouse   193 TKLDLSSLAYSGK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 92/97 (95%)
FxnNP_032070.1 mito_frataxin 91..189 CDD:132463 92/97 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83961641
Domainoid 1 1.000 215 1.000 Domainoid score I23534
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47908
Inparanoid 1 1.050 288 1.000 Inparanoid score I15260
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG37510
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto123247
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1515.400

Return to query results.
Submit another query.