Sequence 1: | NP_000135.2 | Gene: | FXN / 2395 | HGNCID: | 3951 | Length: | 210 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017944796.1 | Gene: | fxn / 100497789 | XenbaseID: | XB-GENE-984730 | Length: | 233 | Species: | Xenopus tropicalis |
Alignment Length: | 195 | Identity: | 112/195 - (57%) |
---|---|---|---|
Similarity: | 132/195 - (67%) | Gaps: | 40/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Human 51 TPRRASSNQRGLNQIWNVK------------KQSVYLMNLRKSGTLGHPGSLDETTYERLAEETL 103
Human 104 DSLAEFFEDLADKPYTFEDYDVSFG---------------------------SGVLTVKLGGDLG 141
Human 142 TYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYS 206
Human 207 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FXN | NP_000135.2 | mito_frataxin | 94..192 | CDD:132463 | 86/124 (69%) |
fxn | XP_017944796.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 200 | 1.000 | Domainoid score | I15488 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H47908 | |
Inparanoid | 1 | 1.050 | 222 | 1.000 | Inparanoid score | I11738 |
NCBI | 1 | 1.000 | - | - | ||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1372185at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0004275 | |
OrthoInspector | 1 | 1.000 | - | - | oto155948 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR16821 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X3009 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
12 | 12.070 |