DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and fxn

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:XP_017944796.1 Gene:fxn / 100497789 XenbaseID:XB-GENE-984730 Length:233 Species:Xenopus tropicalis


Alignment Length:195 Identity:112/195 - (57%)
Similarity:132/195 - (67%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    51 TPRRASSNQRGLNQIWNVK------------KQSVYLMNLRKSGTLGHPGSLDETTYERLAEETL 103
            |...:||..||. ||:.::            .::..|:..|.:|||.:..||||||||:||||||
 Frog    35 TAGSSSSQYRGF-QIFKIQTLQSFSHLLDPATRNSLLLCRRNAGTLSNTSSLDETTYEKLAEETL 98

Human   104 DSLAEFFEDLADKPYTFEDYDVSFG---------------------------SGVLTVKLGGDLG 141
            ||||||||||||:|:|.||||||||                           :||||||||||:|
 Frog    99 DSLAEFFEDLADQPFTPEDYDVSFGLQILNVLWAAAEKQNMGAISNHQAKNKNGVLTVKLGGDMG 163

Human   142 TYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYS 206
            ||||||||||||||||||:||||||||||:.||||||||:||||||.||:..||.|:|||:|.||
 Frog   164 TYVINKQTPNKQIWLSSPTSGPKRYDWTGRTWVYSHDGVALHELLAKELSAVLKNKIDLSNLLYS 228

Human   207  206
             Frog   229  228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 86/124 (69%)
fxnXP_017944796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I15488
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47908
Inparanoid 1 1.050 222 1.000 Inparanoid score I11738
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto155948
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.070

Return to query results.
Submit another query.