DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpr34 and AstC-R1

DIOPT Version :9

Sequence 1:NP_035953.3 Gene:Gpr34 / 23890 MGIID:1346334 Length:375 Species:Mus musculus
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:402 Identity:97/402 - (24%)
Similarity:161/402 - (40%) Gaps:64/402 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 TTTSVDSWLCSSHGMHFITNYSDQASQNFSG--VPNVTSCPMDEKLLSTVLT-TFYSVIFLVGLV 63
            ||.....|:..|..:        |..::..|  :|....|.......:.:.| ..|..:.::||.
  Fly    37 TTELNHRWISGSSTI--------QPEESLYGTDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLF 93

Mouse    64 GNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFY 128
            ||.:.:||.|...:.:....||:||:||||...:..:|| ::|.:....|..|..:||.......
  Fly    94 GNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPF-LLYTMRICSWRFGEFMCKAYMVSTS 157

Mouse   129 MNMYISIILLGFISLDRYIKINRSIQQRRAITTKQSIYVCCIVWTVALAGFLTMIILTL---KKG 190
            :..:.|.|.|..:|.||||.:...|...|..|...:..|..|.|:.:....|.:|:...   ::.
  Fly   158 ITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQED 222

Mouse   191 GHNSTMCFHYRDRHNAKGEAIFNFVLVVMFWLIF---LLIILSYIKIGKNLLRISKRRSKFPNSG 252
            |.|.:....:.|.:.......|   ::..|:|.|   |..|||:.     .|.|.|.||..|..|
  Fly   223 GINYSCNIMWPDAYKKHSGTTF---ILYTFFLGFATPLCFILSFY-----YLVIRKLRSVGPKPG 279

Mouse   253 KYATTARNS--------FIVLIIFTICFVPYHAFRFIYISS---QLNVSSCYWKEIIHKTNEIM- 305
            ..:...|.:        ..|:.::.:|::|:...:...|.|   |.::|..          ||: 
  Fly   280 TKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRL----------EILI 334

Mouse   306 ------LVFSSFNSCLDPVMYFLMSSNIRK-----IMC---QLLFRRFQSEASRSESTSEFKPGH 356
                  ||:|  ||.::|::|..:|.|.||     ..|   |.:..:.|.|.|........|.|.
  Fly   335 FLLLGALVYS--NSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRGG 397

Mouse   357 SLHDLSVTVKMP 368
            |...|:...::|
  Fly   398 SKRLLTSNPQIP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpr34NP_035953.3 7tmA_GPR34-like 48..331 CDD:320276 79/312 (25%)
TM helix 1 50..74 CDD:320276 8/24 (33%)
TM helix 2 83..104 CDD:320276 10/20 (50%)
TM helix 3 121..143 CDD:320276 4/21 (19%)
TM helix 4 166..182 CDD:320276 4/15 (27%)
TM helix 5 209..232 CDD:320276 8/25 (32%)
TM helix 6 258..280 CDD:320276 4/29 (14%)
TM helix 7 299..324 CDD:320276 9/31 (29%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 77/300 (26%)
7tm_1 94..353 CDD:278431 70/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.