DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets2 and Ets65A

DIOPT Version :9

Sequence 1:NP_035939.3 Gene:Ets2 / 23872 MGIID:95456 Length:468 Species:Mus musculus
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:323 Identity:108/323 - (33%)
Similarity:147/323 - (45%) Gaps:82/323 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   191 INSNTLGFSMEQAPYGMQAPNYPKDNLLDSMCPP----------------------------SAT 227
            ::|:|.|. :..:..|:|.      :.||::.||                            ||.
  Fly   126 VSSSTAGV-LSSSGNGVQR------HRLDTLQPPSGCSPAVTQHGVITSSAGQVTSGTLDAVSAA 183

Mouse   228 P------AALGSELQMLPKSRLNTVNVNYCSISQDFPSSNVNLLNNNSGK---PKDHDSPENGGD 283
            |      |:..|.::...::..:|::....|.....|||:.:..::..|:   .|..::...||.
  Fly   184 PALPSLTASSSSHVEHKVRADKSTLDCATTSSHAAAPSSSSSASDHQQGRISGSKSSNTSGTGGG 248

Mouse   284 SFESS-------DSLLRSWNSQSSLLDVQRVPSFESFEEDCSQSLCLSKLTMSFKDYIQERS-DP 340
            :..|.       .|...||.|.||..               ||....:.|.:....:.|.|. ||
  Fly   249 ASASGGGGSALYSSYKSSWGSHSSTQ---------------SQGYSSNALGIKHDPHSQLRQPDP 298

Mouse   341 VEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKR 405
            .:...|.  ::.||. :|||.|||||||||||||.:..|.|:|.|...||||.||||||||||:|
  Fly   299 YQMFGPT--SSRLAS-SGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGER 360

Mouse   406 KNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED 468
            |:||.|||:||||.|||||||||:.|..||||.|:|  |.|.|...|          ||...|
  Fly   361 KSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAAT----------QPAASD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets2NP_035939.3 SAM_PNT-ETS-2 85..173 CDD:188884
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..290 5/37 (14%)
ETS 361..445 CDD:197710 58/83 (70%)
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 60/86 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.