DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets1 and Ets97D

DIOPT Version :9

Sequence 1:NP_001359463.1 Gene:Ets1 / 23871 MGIID:95455 Length:484 Species:Mus musculus
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:436 Identity:117/436 - (26%)
Similarity:184/436 - (42%) Gaps:147/436 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    56 ETATQEVPTGLEHCGSDMECADVPLLTPSSKEMMSQALKATFSG--------------FTKEQQR 106
            |||:|:           ...::.|:.||..:.....:.:.:..|              |.:||.|
  Fly   142 ETASQK-----------SSSSESPIKTPLKRMHKEDSEEESVEGKDVKPVLNWVLDSKFKREQIR 195

Mouse   107 LGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWE 171
            |.||:...:||..||..|:.|||.:|.|.|::...:.|:|..|||:..|.|.:..|...|:|.|.
  Fly   196 LKIPEAANEWTHAHVTYWLEWAVKQFELVGINMSDWQMNGQELCAMTHEEFNQKLPRDPGNIFWT 260

Mouse   172 HLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPIS 236
            ||::|:                                           |.:|::    .:|..:
  Fly   261 HLQLLK-------------------------------------------ECNFVS----VVHKRA 278

Mouse   237 SEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVES 301
            .|:     .:...|.::..:.:.|::  ....:::|.::                 :.|::||:|
  Fly   279 EEQ-----RKPKQPRIMSANSISTNS--GGSLSLEQRIM-----------------RKSYQSVKS 319

Mouse   302 YDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIP 366
            .||.:..|.| .:.|::.::                                             
  Fly   320 SDSVESTTSS-MNPSNYTTI--------------------------------------------- 338

Mouse   367 AAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYE 431
                 |...:|.:||||||||:|||......|.|.|...||||:|||.|||.||::||||.||||
  Fly   339 -----GSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYE 398

Mouse   432 KLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAML 477
            ||||.||||||.::|.|.:|||:.|:|.|||:.|:||...||..::
  Fly   399 KLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLIGYDANELSTLV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets1NP_001359463.1 SAM_PNT-ETS-1 95..182 CDD:176092 33/100 (33%)
ETS 378..462 CDD:197710 52/83 (63%)
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084 34/130 (26%)
ETS 345..429 CDD:197710 52/83 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.