DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Def8 and Plekhm1

DIOPT Version :9

Sequence 1:XP_036009874.1 Gene:Def8 / 23854 MGIID:1346331 Length:499 Species:Mus musculus
Sequence 2:NP_611639.1 Gene:Plekhm1 / 37520 FlyBaseID:FBgn0034694 Length:720 Species:Drosophila melanogaster


Alignment Length:474 Identity:126/474 - (26%)
Similarity:200/474 - (42%) Gaps:103/474 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    77 HHEQEPSEKV-TSEDTLPELPAGEP--EFHYSERMMDLGLSEDHFSRPVGLFLASDVQQLRQAIE 138
            :.||...:|. |:|....|.|:|..  ....|.|.||.....|                      
  Fly   280 NEEQTGGDKAETNETAEQEAPSGSKTRSRKKSNRQMDSSSFAD---------------------- 322

Mouse   139 ECKQVILELPEQSEKQKDAVVRLIHLRLKLQELK----DPNEEEPNIRVLLEHRFYKEKSKSVKQ 199
                :.||.|....:..:::..|:..... .:|:    .|.||      |...||: ::|.||..
  Fly   323 ----LDLEAPSLLPQGSNSLSNLMQTSWS-GDLEATPTSPTEE------LTGSRFF-QRSVSVSS 375

Mouse   200 -------TCDKC--NTII------------WGLIQTWYTCTGCCYRCHSKCLNLI-----SKPCV 238
                   |.|:|  |.::            |.  :.|..     :|..:..||:.     :.|.:
  Fly   376 SVSLRSPTTDRCSYNALLRKHESNRESGAGWS--EIWEK-----FRASASNLNVAQPQRDTDPPI 433

Mouse   239 SSKVSH------QAEYEL---------------NICP---ETGLDSQDYRCAECRAPISLRGVPS 279
            |..:|.      .:|:||               .:|.   |.|||:|.:.|..|:.|:.: |. |
  Fly   434 SEDLSDLQSLDTNSEFELLTSEFDMVELQQMVAQLCQLAREPGLDAQGFLCKSCQHPLGI-GY-S 496

Mouse   280 EARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRLREINPLL 344
            ..:.|.::|.|||:.|...::.:||||:::||||....||:.:..:||...|.|.|.::.:||.:
  Fly   497 NFQVCAFSGSYYCNSCMDVEMQLIPARIIYNWDFRKYSVSKRAATFLAEFRSHPFLDMQLLNPRI 561

Mouse   345 FNYVEELVEIRKLRQDILLMKPYFITCKEAMEARLLLQLQDRQHFVENDEMYSIQDLLEVHMGRL 409
            :...:.:.|::.||..:..::.|..||..:....|..|...|::..|:..:|||.||..:..|.|
  Fly   562 YFASDAMAELQSLRIRLNFIRAYLYTCAPSSIELLQNQFAGREYLYEHIHLYSIADLALIQRGVL 626

Mouse   410 SCSLTEIHTLFAKHIKLDCERCQAKGFVCELCKEGDVLFPFD-SHTSVCNDCSAVFHRDCYYDNS 473
            ...|.:...|...|: |.|..|..|||:||:|:...||:||. |.|..|..|.||||.:| .:..
  Fly   627 CQQLQKAFKLGEAHV-LKCRLCHLKGFICEICQSPRVLYPFHISTTFRCLACGAVFHAEC-LNEK 689

Mouse   474 TTCPKCARLTLRKQSLFQE 492
            ..||||.|:..|:....||
  Fly   690 QPCPKCERIRKREDQGLQE 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Def8XP_036009874.1 C1_DEF8 182..242 CDD:410369 17/85 (20%)
zf-RING_9 284..481 CDD:404739 69/197 (35%)
Plekhm1NP_611639.1 RUN 54..185 CDD:280855
zf-RING_9 500..700 CDD:290612 70/201 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4753
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.