DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdh20 and CadN

DIOPT Version :9

Sequence 1:NP_035930.1 Gene:Cdh20 / 23836 MGIID:1346069 Length:801 Species:Mus musculus
Sequence 2:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster


Alignment Length:573 Identity:183/573 - (31%)
Similarity:282/573 - (49%) Gaps:73/573 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    71 EYTGTDPLYVGKLHSDMDRGDGSIKYILSGEG------AGIVFTIDDTTGDIHAIQRLDREE--- 126
            :.|.||        .|.||.. :|.|.|:|:|      |...|.|:.|||:|..::.|||::   
  Fly  1541 QVTATD--------GDKDRPQ-NIVYFLTGQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNG 1596

Mouse   127 RAQYTLRAQALDRRTGRPMEPESEFIIKIQDINDNEPKFLDGPYIATVPEMSPVGTSVIQVTATD 191
            |.|:.....|.| ..|..:...::..:.::|||||.|.|..|.|...|.|....|..|:.:||.|
  Fly  1597 RPQWRFTVFAQD-EGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVTENGTAGMVVMTMTAVD 1660

Mouse   192 ADDPTYGNSARVVYSILQ-------GQPYFSVDSKTGVIRTALMNMDREAKEYYEVIIQAKDMGG 249
            .|||..|::||:||||.:       |.|.|.::..||||:||:..:|||....|.:.:.|.|.  
  Fly  1661 YDDPNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTGVIKTAVCCLDRERTPDYSIQVVAMDG-- 1723

Mouse   250 QLGGLAGTTTVNITLSDVNDNPPRFPQKHYQMSV-------LESAPISSTVGRVFAKDLDEGINA 307
              |||.||.|.:|.:.|:||.||:|.:..:...|       |...||.:    |...|.||  ..
  Fly  1724 --GGLKGTGTASIRVKDINDMPPQFTKDEWFTEVDETDGTALPEMPILT----VTVHDEDE--TN 1780

Mouse   308 EMKYTIVD--GDGADAFDINTDQNFQVGIITVKKPLSFESKKSYTLKVEGSNPHLEMRFLNLGPF 370
            :.:|.::|  |.|||.|.: ...|...|.:.:.:||.:|.:    |:..|....:::.  :.|..
  Fly  1781 KFQYKVIDNSGYGADKFTM-VRNNDGTGSLKIVQPLDYEDQ----LQSNGFRFRIQVN--DKGED 1838

Mouse   371 QDTTTVHIS-------VEDV-DEPPVFEPGFYFVEVPEDVTIGTTIQIISAKDPDVTNNS-IRYS 426
            .|....|::       :.|: |..|.||.....|.|.||..:||.::...|.|||....| :.||
  Fly  1839 NDNDKYHVAYSWVVVKLRDINDNKPHFERANVEVSVFEDTKVGTELEKFKATDPDQGGKSKVSYS 1903

Mouse   427 IDRGSDPGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVAVTIKVLDVNDNA 491
            |||.||..|.|.:: ..|::...|.||||....|.:.:||::..:|.:..:..:|:.|.|:||||
  Fly  1904 IDRSSDRQRQFAIN-QNGSVTIQRSLDREVVPRHQVKILAIDDGSPPKTATATLTVIVQDINDNA 1967

Mouse   492 PEFPRFYEAFICENAKAGQLIQTVSAVDQDD--PHNGQHFYYSLAPEAAN--NPNFTVRDNQ--- 549
            |:|.:.|...:.|:....:::: :.|.|.||  ..||..|.:.|.|.|.:  ..:|.|..:|   
  Fly  1968 PKFLKDYRPVLPEHVPPRKVVE-ILATDDDDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGA 2031

Mouse   550 --DNTARILTRRSGFRQQEQSVFYLPILIADSGQPVLSSTGTLTIQVCSCNDD 600
              |..|.|.:.|| |.:::|..:.:||:|.|.|.|.::.|.|||:.:...||:
  Fly  2032 NGDGMAVISSLRS-FDREQQKEYMIPIVIKDHGSPAMTGTSTLTVIIGDVNDN 2083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdh20NP_035930.1 CA 85..163 CDD:214520 28/86 (33%)
Cadherin_repeat 169..270 CDD:206637 42/107 (39%)
Cadherin_repeat 278..385 CDD:206637 26/123 (21%)
Cadherin_repeat 394..490 CDD:206637 34/96 (35%)
Cadherin_repeat 498..599 CDD:206637 32/109 (29%)
Cadherin_C 643..794 CDD:366437
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637 29/98 (30%)
Cadherin_repeat 1638..1741 CDD:206637 41/106 (39%)
Cadherin_repeat 1762..1861 CDD:206637 25/111 (23%)
Cadherin_repeat 1871..1966 CDD:206637 34/95 (36%)
Cadherin_repeat 1974..2083 CDD:206637 33/110 (30%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.