DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Banf1 and baf

DIOPT Version :9

Sequence 1:NP_001033320.1 Gene:Banf1 / 23825 MGIID:1346330 Length:89 Species:Mus musculus
Sequence 2:NP_001260220.1 Gene:baf / 34095 FlyBaseID:FBgn0031977 Length:90 Species:Drosophila melanogaster


Alignment Length:87 Identity:55/87 - (63%)
Similarity:71/87 - (81%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 TSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTC 67
            ||||||:|||||||.|.|..|||||:.|..||::.|||.||.||||:|||||||:||::|:|:.|
  Fly     4 TSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQYLVLKKDEELFKDWMKEVC 68

Mouse    68 GANAKQSRDCFGCLREWCDAFL 89
            .|::||:.||:.||.:||:.||
  Fly    69 HASSKQASDCYNCLNDWCEEFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Banf1NP_001033320.1 BAF 1..86 CDD:281026 52/82 (63%)
bafNP_001260220.1 BAF 2..87 CDD:281026 52/82 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5379
eggNOG 1 0.900 - - E1_KOG4233
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2866
Inparanoid 1 1.050 128 1.000 Inparanoid score I4656
Isobase 1 0.950 - 0 Normalized mean entropy S2102
OMA 1 1.010 - - QHG48331
OrthoDB 1 1.010 - - D1617480at2759
OrthoFinder 1 1.000 - - FOG0006364
OrthoInspector 1 1.000 - - oto93949
orthoMCL 1 0.900 - - OOG6_107233
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2418
SonicParanoid 1 1.000 - - X5319
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.720

Return to query results.
Submit another query.