DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTCH2 and CG10920

DIOPT Version :9

Sequence 1:NP_001304160.1 Gene:MTCH2 / 23788 HGNCID:17587 Length:314 Species:Homo sapiens
Sequence 2:NP_572408.2 Gene:CG10920 / 31688 FlyBaseID:FBgn0029963 Length:397 Species:Drosophila melanogaster


Alignment Length:287 Identity:99/287 - (34%)
Similarity:148/287 - (51%) Gaps:28/287 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    13 GLTILSQPLMYVKVLIQVGYEPL--PPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLT 75
            |...|..|....|||||:|:|||  .|.:.|.|..|....||.:..|.|||..|||..|::.|||
  Fly   114 GYNTLLYPYEMAKVLIQLGHEPLQAKPFVMRLIQRRPRLFLPSVHRYVQHIQHIDGYTGMYRGLT 178

Human    76 PRLCSGVLGTVVHGKVLQ--HYQESDKGEELGPGNVQKEVSSSFDHVIKE----TTREMIARSAA 134
            .||.:.::..::...:|.  |:....:|.:.|..             :||    .||..:..:..
  Fly   179 ARLAASIVDYLLGDLLLATLHFAPYKRGPKEGLS-------------LKEFWWNLTRNSLRITTV 230

Human   135 TLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSL 199
            .:|||||:|:.:|.:.||:|.|..|.||..|::|:.::||..|.|||:||||||:...|::.::|
  Fly   231 VVITHPFYVVMVRQIAQFVGGEHVYEGLVGSLMTLAQQEGCAGLFAGMVPRLLGEWSVLFITSAL 295

Human   200 AYLVNTYALDSGVSTMNEMK-SYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYT 263
            ::|...      :..|:|:: .|:.||....||::.||..:.|..||.....|....||..|:|.
  Fly   296 SHLCRR------LLPMSELQHQYNTAVIQMMASLVAYPLEVTSTCMAGTGAPLTACEPPSMPLYN 354

Human   264 SWIDCWCMLQKEGNMSRGNSLFFRKVP 290
            .|:||...|...|..:||..||:|.||
  Fly   355 HWVDCLTDLYARGGQNRGAILFWRTVP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTCH2NP_001304160.1 Mito_carr 128..>192 CDD:278578 28/63 (44%)
CG10920NP_572408.2 Mito_carr 231..>284 CDD:278578 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155478
Domainoid 1 1.000 64 1.000 Domainoid score I10116
eggNOG 1 0.900 - - E1_KOG2745
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3768
OMA 1 1.010 - - QHG49093
OrthoDB 1 1.010 - - D1439019at2759
OrthoFinder 1 1.000 - - FOG0004199
OrthoInspector 1 1.000 - - mtm8643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10780
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.