Sequence 1: | NP_001129685.1 | Gene: | POTEH / 23784 | HGNCID: | 133 | Length: | 545 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524367.1 | Gene: | Act88F / 41885 | FlyBaseID: | FBgn0000047 | Length: | 376 | Species: | Drosophila melanogaster |
Alignment Length: | 212 | Identity: | 44/212 - (20%) |
---|---|---|---|
Similarity: | 78/212 - (36%) | Gaps: | 53/212 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 263 LEHGTDPNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKHGLTPLLLGVHEQKQQV 324
Human 325 VKFLIKKKANLNALDRYGRTALILAVCCGSASIVSL---------LLEQNIDVSSQDLSG----- 375
Human 376 ---------QTAREYAVSSRHNVICQLLSDYKEKQILKVSSENSNPEQDLKLTSEEESQRLK--- 428
Human 429 ----GSENSQ-PEEMSQ 440 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
POTEH | NP_001129685.1 | Ank_4 | 180..230 | CDD:290365 | |
ANK 1 | 180..208 | ||||
ANK | 204..329 | CDD:238125 | 16/68 (24%) | ||
ANK 2 | 209..238 | ||||
ANK repeat | 211..240 | CDD:293786 | |||
Ank_2 | 214..306 | CDD:289560 | 13/45 (29%) | ||
ANK repeat | 242..273 | CDD:293786 | 4/9 (44%) | ||
ANK 3 | 242..271 | 3/7 (43%) | |||
ANK | 270..394 | CDD:238125 | 29/149 (19%) | ||
ANK repeat | 275..306 | CDD:293786 | 8/33 (24%) | ||
ANK 4 | 275..304 | 7/30 (23%) | |||
Ank_2 | 280..372 | CDD:289560 | 21/103 (20%) | ||
ANK repeat | 308..339 | CDD:293786 | 5/30 (17%) | ||
ANK 5 | 308..337 | 4/28 (14%) | |||
ANK repeat | 341..372 | CDD:293786 | 6/39 (15%) | ||
ANK 6 | 341..370 | 6/37 (16%) | |||
ANK 7 | 374..404 | 5/43 (12%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 406..524 | 11/43 (26%) | |||
Act88F | NP_524367.1 | PTZ00281 | 1..376 | CDD:173506 | 44/212 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100127 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.710 |