DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARHGAP8 and RhoGAP68F

DIOPT Version :9

Sequence 1:NP_001017526.1 Gene:ARHGAP8 / 23779 HGNCID:677 Length:464 Species:Homo sapiens
Sequence 2:NP_001261744.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster


Alignment Length:395 Identity:139/395 - (35%)
Similarity:207/395 - (52%) Gaps:44/395 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    27 GDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQ 91
            |.|:.||.:......|.|...:|: ..:.|.:| .::.:|||||.:||||.||...||||..:|.
  Fly   105 GTDKQGRHIFGIYASRFPEKSQLE-GFVREIIK-EIEPFVENDYILVYFHQGLKEDNKPSAQFLW 167

Human    92 SAYKEFDRKDGDLTMWPRLVSNSKLKRSSHLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILK 156
            ::|||.||                               .::||||.|||||||.||:|:||...
  Fly   168 NSYKELDR-------------------------------NFRKNLKTLYVVHPTWFIRVIWNFFS 201

Human   157 PLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKT-----PPPR 216
            |.||.||.||::|.:.|.||.:.|..::|.:|..:...|:||....:..||||:..     ....
  Fly   202 PFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLDDKLNPSRKPSTPPPSSNINASRQQQH 266

Human   217 PPLPTQQFGVSLQYLKDKNQGEL--IPPVLRFTVTYLREKG-LRTEGLFRRSASVQTVREIQRLY 278
            ....|.||||.|:::. .|...|  |||::|..|..|...| :.|||:||||.:...:..::...
  Fly   267 KMATTHQFGVPLKFIV-MNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERV 330

Human   279 NQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILR-SLP 342
            |:|:.|:.... ::|:.|.:||:|||:|.:|||||:.||.:.|........|.....|::| .||
  Fly   331 NRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLP 394

Human   343 EHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEY 407
            |.||.:.:|::.||..|......|||.|||||.|||.|.:|.....:||..:.|:|.|.:.:::.
  Fly   395 EENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQN 459

Human   408 YEKIF 412
            ::.|:
  Fly   460 HKDIY 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARHGAP8NP_001017526.1 SEC14 12..188 CDD:238099 59/160 (37%)
RhoGAP 222..412 CDD:295372 70/193 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..464
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099 59/160 (37%)
RhoGAP-p50rhoGAP 269..464 CDD:239869 71/196 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5646
eggNOG 1 0.900 - - E1_KOG4406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3119
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52084
OrthoDB 1 1.010 - - D1511935at2759
OrthoFinder 1 1.000 - - FOG0002972
OrthoInspector 1 1.000 - - otm40896
orthoMCL 1 0.900 - - OOG6_103505
Panther 1 1.100 - - O PTHR45808
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3319
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.