Sequence 1: | NP_036313.3 | Gene: | FKBP8 / 23770 | HGNCID: | 3724 | Length: | 413 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001368980.1 | Gene: | CG1847 / 32144 | FlyBaseID: | FBgn0030345 | Length: | 390 | Species: | Drosophila melanogaster |
Alignment Length: | 327 | Identity: | 81/327 - (24%) |
---|---|---|---|
Similarity: | 124/327 - (37%) | Gaps: | 69/327 - (21%) |
- Green bases have known domain annotations that are detailed below.
Human 102 LRKKTLVPG------PPGSSRPVKGQVVTVHLQTSLENGTRV------QEEP-ELVFTLGDCDVI 153
Human 154 QALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYI----------PPHAALCLEVTLKTAVDG- 207
Human 208 ----------PDLE-------------------MLTGQERVALANRKRECGNAHYQRADFVLAAN 243
Human 244 SYDLAIKAITSSAKVDMTFEEEAQ-LLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNI 307
Human 308 KALFRKGKVLAQQGEYSEAIPILRAALKLEPSNK-TIHAELSKLVKKHAAQRSTETALYRKMLGN 371
Human 372 PS 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FKBP8 | NP_036313.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..68 | ||
FKBP_C | 113..202 | CDD:278674 | 25/105 (24%) | ||
TPR_11 | 222..304 | CDD:290150 | 22/82 (27%) | ||
TPR 1 | 222..255 | 9/32 (28%) | |||
TPR repeat | 231..267 | CDD:276809 | 7/35 (20%) | ||
TPR repeat | 272..302 | CDD:276809 | 9/29 (31%) | ||
TPR 2 | 273..306 | 9/32 (28%) | |||
TPR_11 | 274..338 | CDD:290150 | 21/63 (33%) | ||
TPR 3 | 307..340 | 11/32 (34%) | |||
TPR | 307..340 | CDD:197478 | 11/32 (34%) | ||
TPR repeat | 307..335 | CDD:276809 | 9/27 (33%) | ||
TPR repeat | 341..369 | CDD:276809 | 6/28 (21%) | ||
CG1847 | NP_001368980.1 | FKBP_C | 23..>92 | CDD:395196 | 20/77 (26%) |
3a0801s09 | 150..>308 | CDD:273380 | 41/157 (26%) | ||
TPR repeat | 173..217 | CDD:276809 | 11/43 (26%) | ||
TPR repeat | 222..252 | CDD:276809 | 9/29 (31%) | ||
TPR repeat | 257..285 | CDD:276809 | 9/27 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |