DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP8 and CG1847

DIOPT Version :9

Sequence 1:NP_036313.3 Gene:FKBP8 / 23770 HGNCID:3724 Length:413 Species:Homo sapiens
Sequence 2:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster


Alignment Length:327 Identity:81/327 - (24%)
Similarity:124/327 - (37%) Gaps:69/327 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   102 LRKKTLVPG------PPGSSRPVKGQVVTVHLQTSLENGTRV------QEEP-ELVFTLGDCDVI 153
            :||:.|.||      .||:.       |..|.||.....:|:      .|:| |||  ||....:
  Fly    12 IRKEILNPGNAYIELTPGTR-------VKFHFQTRRAGDSRIIDDSRKMEKPMELV--LGKKFKL 67

Human   154 QALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYI----------PPHAALCLEVTLKTAVDG- 207
            :..:|.|..|.:.|.|..|.....|     ::.|:|          |.....|..:||:....| 
  Fly    68 EVWELIVQQMSLNEVAKFTVHKSLC-----AQYPFISKTLRDIGKKPEERRHCCGMTLQNEGIGY 127

Human   208 ----------PDLE-------------------MLTGQERVALANRKRECGNAHYQRADFVLAAN 243
                      .|||                   .::..|::...:..||.||..|:.:.|..|..
  Fly   128 TDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAET 192

Human   244 SYDLAIKAITSSAKVDMTFEEEAQ-LLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNI 307
            .|..|:..:......:...:||.| |..:|...|.|.|..:|....:.|.:..|:.||...|.|:
  Fly   193 CYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNV 257

Human   308 KALFRKGKVLAQQGEYSEAIPILRAALKLEPSNK-TIHAELSKLVKKHAAQRSTETALYRKMLGN 371
            |||||:.|..|.....::|......||.|:.|.| |:..||..:..:..|:...:....:|:. |
  Fly   258 KALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQKLFXN 322

Human   372 PS 373
            .|
  Fly   323 IS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP8NP_036313.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68
FKBP_C 113..202 CDD:278674 25/105 (24%)
TPR_11 222..304 CDD:290150 22/82 (27%)
TPR 1 222..255 9/32 (28%)
TPR repeat 231..267 CDD:276809 7/35 (20%)
TPR repeat 272..302 CDD:276809 9/29 (31%)
TPR 2 273..306 9/32 (28%)
TPR_11 274..338 CDD:290150 21/63 (33%)
TPR 3 307..340 11/32 (34%)
TPR 307..340 CDD:197478 11/32 (34%)
TPR repeat 307..335 CDD:276809 9/27 (33%)
TPR repeat 341..369 CDD:276809 6/28 (21%)
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 20/77 (26%)
3a0801s09 150..>308 CDD:273380 41/157 (26%)
TPR repeat 173..217 CDD:276809 11/43 (26%)
TPR repeat 222..252 CDD:276809 9/29 (31%)
TPR repeat 257..285 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.