DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FLRT2 and CG18095

DIOPT Version :9

Sequence 1:NP_001333072.1 Gene:FLRT2 / 23768 HGNCID:3761 Length:660 Species:Homo sapiens
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:459 Identity:103/459 - (22%)
Similarity:183/459 - (39%) Gaps:127/459 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    68 LYLHNNQIN--NAGFPAELHNVQSVHTVYLYGN-----QLDEFPMNLPKNVRVLHLQEN---NIQ 122
            |||:.||:.  :..|...||.:.|:.   |..|     ::|.|..|  .::|.|.|.:|   ::|
  Fly   164 LYLNGNQLAHIDGSFFRGLHRLSSLS---LQHNRIEFIEMDSFESN--THLRSLRLDQNLLSSLQ 223

Human   123 TISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVP----VGLPVDLQ 183
            .:|:..||:|:   .|:|..|.:..  :|...|.:...|:.|.||.|:::.:.    .||. .|:
  Fly   224 FLSQRGLARLV---HLNLSSNLLQK--LEPFVFSKNFELQDLDLSYNNITKLNKEALSGLD-SLE 282

Human   184 ELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRNSLSHPPPD 248
            .|.:..|.:..|.|.:..:|.:|.:|.:..||||.  :.:..|...|:|:|..:..|.:..... 
  Fly   283 RLNISHNYVDKIYDESLDSLIALLQLDISFNLLTT--LPDNLFHFNTQLEEIILANNKIEEISS- 344

Human   249 LPGTHLIRLYLQDNQINHIPLT--AFSNLRKLERL-----------DISNNQLRMLTQGVFDNLS 300
                   ::....|.:.:|.|:  |.|:...|:||           |:|:|:|:.|      |||
  Fly   345 -------QMMFNQNHLRYIKLSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSL------NLS 396

Human   301 NL---KQLTARNNPWFCDCSIKW-VTEWLKYIPSSLN------VRGFMCQGPEQVRGMAVRELNM 355
            :|   :.:...:|.|.|:    | |...::.:|:|:|      |...:.:....|.|:...|...
  Fly   397 SLLHFRYINLADNNWSCN----WLVANLVQKLPNSVNFARPWTVINNLSENTTNVEGIDCIEGGT 457

Human   356 NLLSCPTTTPGLPLFTPAPSTASPTTQPPT--------LSIPNPSRSYTPPTPTTSKLPTIPDWD 412
            |.........|:|             ||.:        ....|||    ||..|..|:||     
  Fly   458 NRSIILLDVSGVP-------------QPKSDNCDCVVAYDETNPS----PPPLTWPKIPT----- 500

Human   413 GRERVTPPISERIQLSIHFVNDTSIQVSWLSLFTVMAYK-LTWV----------KMGHSLVGGIV 466
                      :|.        |:...:.|:.:...:|:. |.|:          |:|..::..:.
  Fly   501 ----------DRF--------DSRSVIIWMLVAIAIAFSGLRWLRRFVDRNEKRKLGQKMLHNVY 547

Human   467 QERI 470
            ..::
  Fly   548 VSKV 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FLRT2NP_001333072.1 LRRNT 35..66 CDD:214470
NEL <54..>265 CDD:330839 53/210 (25%)
LRR 1 64..85 6/18 (33%)
leucine-rich repeat 65..86 CDD:275378 7/19 (37%)
LRR 2 89..109 6/24 (25%)
leucine-rich repeat 90..110 CDD:275380 5/24 (21%)
LRR 3 110..131 7/23 (30%)
leucine-rich repeat 111..134 CDD:275380 9/25 (36%)
LRR 4 134..155 4/20 (20%)
leucine-rich repeat 135..160 CDD:275380 5/24 (21%)
LRR 5 160..181 7/24 (29%)
leucine-rich repeat 161..181 CDD:275380 7/23 (30%)
leucine-rich repeat 182..205 CDD:275380 6/22 (27%)
LRR 6 182..202 5/19 (26%)
LRR 7 205..225 6/19 (32%)
leucine-rich repeat 206..231 CDD:275380 7/24 (29%)
LRR 8 231..252 3/20 (15%)
leucine-rich repeat 232..253 CDD:275380 3/20 (15%)
LRR_8 252..311 CDD:316378 17/74 (23%)
LRR 9 253..274 4/22 (18%)
leucine-rich repeat 254..277 CDD:275380 5/24 (21%)
LRR 10 277..298 8/31 (26%)
leucine-rich repeat 278..301 CDD:275380 10/33 (30%)
PCC 282..>359 CDD:188093 22/86 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..413 11/47 (23%)
fn3 426..494 CDD:306538 7/56 (13%)
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 60/240 (25%)
LRR_8 135..195 CDD:290566 11/33 (33%)
leucine-rich repeat 137..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380 7/19 (37%)
LRR_8 184..243 CDD:290566 18/66 (27%)
leucine-rich repeat 185..208 CDD:275380 6/27 (22%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 15/62 (24%)
leucine-rich repeat 233..256 CDD:275380 6/27 (22%)
leucine-rich repeat 257..280 CDD:275380 7/23 (30%)
LRR_8 280..339 CDD:290566 17/60 (28%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.