DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FLRT3 and Lrt

DIOPT Version :9

Sequence 1:NP_037413.1 Gene:FLRT3 / 23767 HGNCID:3762 Length:649 Species:Homo sapiens
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:619 Identity:132/619 - (21%)
Similarity:232/619 - (37%) Gaps:158/619 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    20 QVAPL------SVMAKSCPSV---------CRCDA-----------GFIYCNDRFLTSIPTGIPE 58
            ||:.|      ::|...||::         |.||.           |.:...||..|| |..|. 
  Fly   115 QVSSLPLPVDDALMEWKCPNITGTRNAELECGCDLPHTLRCNIDLHGMMLLADRLRTS-PYSIS- 177

Human    59 DATTLYLQNNQINNAGIPSDLK--------NLL----KVERIY---------------LYHNSLD 96
                  |.:..:.|....||.|        .|:    :::|::               |..|:|.
  Fly   178 ------LLDCSLRNVTFLSDAKIFDNVSLHGLVISSGEIKRVHKSAFLGIRGPLQALGLPGNALM 236

Human    97 EFPTN---LPKYVKELHLQENNIR---TITYDSLSKIPYLEELHLDDNSVSAVS----------- 144
            ..|.|   ....::.|.|..|.|:   |..:..|:.:.|||   |.:|.:|::|           
  Fly   237 SVPWNALSTLSALERLDLANNKIKALGTADFVGLTSLVYLE---LSNNQISSISQRTFVNLRKLE 298

Human   145 -IEEGAFRDSNY------------LRLLFLSRNHLS------TIPWGLPRTIEELRLDDNRISTI 190
             ::.|..|..:|            ||.|.|..|:|:      |:| |: |.:|.|.|:.|.|.:|
  Fly   299 VLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQANNLNGPLSEQTLP-GM-RNLESLNLNRNLIKSI 361

Human   191 SSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTA-APVNLPG-TNLRKLY 253
            .:.:|...:.|..|.|..|.::  .|.|..||.|..|..|.|..|.:.| :..:|.. :.|..|.
  Fly   362 QNKALANFSRLVSLSLRHNQID--VLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLD 424

Human   254 LQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRD 318
            |..|.:..:..:..:.|..|..|.::.|::|.:.:...|....:..|.::.||..|.|.::...:
  Fly   425 LTHNFLRALTSDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAE 489

Human   319 WLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDC------KDSGIVSTIQITTAIPNTVYPA 377
            |||...:..:: ...|..|.::.|..:..:..|...|      ||:..:.....|.|.||...|.
  Fly   490 WLQESQLHSSL-SASCVTPPRLEGAPLLQVPVETLSCDMDNVEKDNANIMQHLETLAKPNQTSPI 553

Human   378 QGQWPAPVTKQPDIKNPKLTKD-HQTT--GSPSRKTITITVKSVTSDTIHISWKLALPMTALRLS 439
            :           |:....:..: |.:|  |......:.::.|....|.|.:       .....::
  Fly   554 K-----------DLSEEIILHELHFSTDYGLILTWLLNLSKKDYMCDAIFV-------YKEEHIN 600

Human   440 WLKLGHSPAFGSITETIVTGERSEYLVTALEPDS-------PYKVCMVPMETSNLYLFDETP--- 494
            .:.:.:||.  .....:|.|:.:   |:.:.|||       .|:.|:|.::       ::.|   
  Fly   601 EILIDNSPI--HCESKVVNGQNT---VSVIVPDSSSLEIGESYRFCLVMIQ-------EQKPDSE 653

Human   495 --VCIETETAPLRMYNPTTTLNREQEKEPYKNPN 526
              :.....|...|.......::|:.::.||.|.|
  Fly   654 LNIGCSNITRLERSSPGAVPVSRQYQRRPYYNAN 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FLRT3NP_037413.1 LRRNT 31..61 CDD:214470 12/49 (24%)
Interaction with ADGRL3. /evidence=ECO:0000269|PubMed:26235030 38..67 9/39 (23%)
LRR 1. /evidence=ECO:0000255 59..80 4/20 (20%)
leucine-rich repeat 61..84 CDD:275378 6/34 (18%)
LRR 2. /evidence=ECO:0000255 84..104 6/37 (16%)
leucine-rich repeat 85..104 CDD:275380 6/36 (17%)
LRR 3. /evidence=ECO:0000255 105..126 6/23 (26%)
LRR_8 106..166 CDD:290566 21/86 (24%)
leucine-rich repeat 106..129 CDD:275380 6/25 (24%)
LRR_RI <120..259 CDD:238064 47/170 (28%)
LRR 4. /evidence=ECO:0000255 129..150 8/32 (25%)
leucine-rich repeat 130..155 CDD:275380 8/36 (22%)
LRR 5. /evidence=ECO:0000255 155..175 10/37 (27%)
leucine-rich repeat 156..176 CDD:275380 9/25 (36%)
LRR_8 175..237 CDD:290566 21/61 (34%)
LRR 6. /evidence=ECO:0000255 176..197 7/20 (35%)
leucine-rich repeat 177..200 CDD:275380 7/22 (32%)
LRR 7. /evidence=ECO:0000255 200..220 6/19 (32%)
leucine-rich repeat 201..226 CDD:275380 9/24 (38%)
LRR 8. /evidence=ECO:0000255 226..247 6/22 (27%)
leucine-rich repeat 227..248 CDD:275380 6/22 (27%)
LRR_8 247..306 CDD:290566 11/58 (19%)
LRR_4 247..287 CDD:289563 9/39 (23%)
LRR 9. /evidence=ECO:0000255 248..269 4/20 (20%)
leucine-rich repeat 249..272 CDD:275380 5/22 (23%)
LRR 10. /evidence=ECO:0000255 272..293 4/20 (20%)
leucine-rich repeat 273..296 CDD:275380 5/22 (23%)
LRRCT 305..356 CDD:214507 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..407 4/22 (18%)
fn3 413..478 CDD:278470 12/71 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..649
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 40/193 (21%)
leucine-rich repeat 179..199 CDD:275378 4/19 (21%)
leucine-rich repeat 200..223 CDD:275380 2/22 (9%)
leucine-rich repeat 225..248 CDD:275380 5/22 (23%)
LRR_8 249..307 CDD:290566 14/60 (23%)
leucine-rich repeat 249..272 CDD:275380 6/22 (27%)
LRR_RI <270..479 CDD:238064 56/215 (26%)
leucine-rich repeat 273..296 CDD:275380 7/25 (28%)
leucine-rich repeat 297..322 CDD:275380 3/24 (13%)
LRR_8 322..382 CDD:290566 21/61 (34%)
leucine-rich repeat 323..347 CDD:275380 9/25 (36%)
leucine-rich repeat 348..371 CDD:275380 7/22 (32%)
LRR_8 370..428 CDD:290566 18/59 (31%)
leucine-rich repeat 372..395 CDD:275380 9/24 (38%)
leucine-rich repeat 396..419 CDD:275380 6/22 (27%)
LRR_8 418..478 CDD:290566 12/59 (20%)
leucine-rich repeat 420..443 CDD:275380 5/22 (23%)
leucine-rich repeat 444..467 CDD:275380 5/22 (23%)
LRRCT 476..526 CDD:214507 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.