| Sequence 1: | NP_001155044.1 | Gene: | MAFF / 23764 | HGNCID: | 6780 | Length: | 164 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286639.1 | Gene: | maf-S / 37336 | FlyBaseID: | FBgn0034534 | Length: | 137 | Species: | Drosophila melanogaster |
| Alignment Length: | 99 | Identity: | 50/99 - (50%) |
|---|---|---|---|
| Similarity: | 73/99 - (73%) | Gaps: | 2/99 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Human 22 PHLSDEALMGLSVRELNRHL--RGLSAEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKS 84
Human 85 ELEREVDKLARENAAMRLELDALRGKCEALQGFA 118 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| MAFF | NP_001155044.1 | bZIP_Maf | 24..115 | CDD:308642 | 46/92 (50%) |
| coiled coil | 47..115 | CDD:269865 | 34/67 (51%) | ||
| Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 51..76 | 20/24 (83%) | |||
| PRK13729 | 78..>162 | CDD:184281 | 13/41 (32%) | ||
| Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 79..93 | 4/13 (31%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 141..164 | ||||
| maf-S | NP_001286639.1 | bZIP_Maf_small | 51..120 | CDD:269865 | 34/68 (50%) |
| coiled coil | 59..110 | CDD:269865 | 28/50 (56%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165143692 | |
| Domainoid | 1 | 1.000 | 102 | 1.000 | Domainoid score | I6837 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG4196 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 107 | 1.000 | Inparanoid score | I4930 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1395389at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001412 | |
| OrthoInspector | 1 | 1.000 | - | - | otm41661 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR10129 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5055 |
| SonicParanoid | 1 | 1.000 | - | - | X1287 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 13 | 12.890 | |||||