DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PITPNB and rdgB

DIOPT Version :9

Sequence 1:XP_011528354.1 Gene:PITPNB / 23760 HGNCID:9002 Length:274 Species:Homo sapiens
Sequence 2:NP_001259535.1 Gene:rdgB / 32340 FlyBaseID:FBgn0003218 Length:1297 Species:Drosophila melanogaster


Alignment Length:283 Identity:106/283 - (37%)
Similarity:167/283 - (59%) Gaps:16/283 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     4 LLMEKCRVVLPCSVQEYQVGQLYSVAEASKNET-GGGEGIEVLKNEPYEKDGE--KGQYTHKIYH 65
            :|:::.|:.||.:|:||::.|||.:|:.|:.|: |.|.|:|::.|||| |||.  .||||.||||
  Fly     1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPY-KDGPGGNGQYTKKIYH 64

Human    66 LKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGL 130
            :.:.:|.:::.:.|:.:|...|:|||||||.||..|..:: :.|.:.|||::.||.|..:||..|
  Fly    65 VGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFV-EKFSLDIETYYYPDNGYQDNVFQL 128

Human   131 DPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKEL-----ANSPDCP 190
            ..:..:...:..|||. :.|:...||..:|||..|.|.||.||||..:|.:|.     ......|
  Fly   129 SGSDLRNRIVDVIDIV-KDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTP 192

Human   191 Q----MCAYKLVTIKFKWWGLQSKVENFIQKQE-KRIFTNFHRQLFCWIDKWIDLTMEDIRRMED 250
            :    |.|||:..::|::||:|:|:|.||.... :::....|||.:.|.|:|..||:||||.:|.
  Fly   193 RNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELER 257

Human   251 ETQKELETLRNQGQVRGTSAASD 273
            :||..|......|:.....:.|:
  Fly   258 QTQLALAKKMGGGEECSDDSVSE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PITPNBXP_011528354.1 SRPBCC_PITPNA-B_like 10..261 CDD:176897 103/263 (39%)
rdgBNP_001259535.1 SRPBCC_PITPNM1-2_like 1..268 CDD:176898 104/269 (39%)
DDHD 746..924 CDD:280937
LNS2 1072..1203 CDD:197870
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.