Sequence 1: | NP_001357916.1 | Gene: | Ptprq / 237523 | MGIID: | 1096349 | Length: | 2301 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 262 | Identity: | 61/262 - (23%) |
---|---|---|---|
Similarity: | 102/262 - (38%) | Gaps: | 66/262 - (25%) |
- Green bases have known domain annotations that are detailed below.
Mouse 29 VYD---ITLSSISATTYSSPVSRTLATN-----VSKP-------GPPVFLAGERVGS---AGILL 75
Mouse 76 SWNTPPNPNGRIISYVVKYKEVCP--WMQTAYTR--VRAKPDSLEVLLTNLNPGTTYEIKVAAEN 136
Mouse 137 SAG-----IGVFSDPFLFQTAESAPGK-VVNLTVEALNYSAVNLIWYLPRQPNGKITSFKISVKH 195
Mouse 196 ARSGIVVKDVSIKVEDLLSGKLPECNENSDSFLWSTTSPSPTLSRATPPLRTTHLSNTLARNKIS 260
Mouse 261 SV 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ptprq | NP_001357916.1 | FN3 | 57..151 | CDD:238020 | 24/112 (21%) |
FN3 | 308..393 | CDD:238020 | |||
fn3 | 399..>441 | CDD:365830 | |||
FN3 | 570..654 | CDD:238020 | |||
fn3 | 668..744 | CDD:365830 | |||
FN3 | 762..850 | CDD:238020 | |||
fn3 | 857..934 | CDD:365830 | |||
FN3 | 951..1049 | CDD:238020 | |||
FN3 | 1056..1137 | CDD:238020 | |||
FN3 | 1152..1233 | CDD:238020 | |||
FN3 | 1247..1337 | CDD:238020 | |||
FN3 | 1342..1421 | CDD:238020 | |||
FN3 | 1432..1535 | CDD:238020 | |||
FN3 | 1542..1638 | CDD:238020 | |||
FN3 | 1645..1734 | CDD:238020 | |||
UP_III_II | 1759..1928 | CDD:297589 | |||
R-PTPc-Q | 2033..2256 | CDD:350464 | |||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | |
Ig | 145..238 | CDD:416386 | 11/40 (28%) | ||
Ig strand A | 145..149 | CDD:409353 | |||
Ig strand A' | 154..159 | CDD:409353 | |||
Ig strand B | 165..172 | CDD:409353 | |||
Ig strand C | 178..183 | CDD:409353 | |||
Ig strand C' | 185..187 | CDD:409353 | |||
Ig strand D | 195..199 | CDD:409353 | 61/262 (23%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 0/8 (0%) | ||
Ig strand G | 230..238 | CDD:409353 | 3/7 (43%) | ||
Ig | 242..333 | CDD:416386 | 22/94 (23%) | ||
Ig strand A' | 250..253 | CDD:409353 | 1/2 (50%) | ||
Ig strand B | 259..266 | CDD:409353 | 0/6 (0%) | ||
Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 295..305 | CDD:409353 | 2/12 (17%) | ||
Ig strand F | 314..322 | CDD:409353 | 0/7 (0%) | ||
Ig strand G | 325..334 | CDD:409353 | 2/8 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |