DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABARAPL1 and Atg8b

DIOPT Version :9

Sequence 1:NP_001350527.1 Gene:GABARAPL1 / 23710 HGNCID:4068 Length:146 Species:Homo sapiens
Sequence 2:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster


Alignment Length:96 Identity:75/96 - (78%)
Similarity:87/96 - (90%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR 65
            |.:|||:||.|:.|:.||:|||:|||||||||||||||.|..:|||:|||||:||||||||||||
  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67

Human    66 KRIHLRPEDALFFFVNNTIPPTSATMGQLYE 96
            |||:|||:|||||||||.|||||||||.||:
  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQ 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABARAPL1NP_001350527.1 Ubiquitin_like_fold 5..96 CDD:391949 72/90 (80%)
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 73/92 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.