DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM1 and dpr21

DIOPT Version :9

Sequence 1:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:265 Identity:54/265 - (20%)
Similarity:92/265 - (34%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     6 PNDFFKRPKFRMLFSLKLHLVTQQKTVQRSAPIAMKASGHTSGDGQNLFTKDVTVIEGEVATISC 70
            |..|.:......|:.:..::|..::.:.|.......|            ||:||.:.|....::|
  Fly    21 PQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSA------------TKNVTSLVGITGHLNC 73

Human    71 QVNKSDDSVIQLLNPNRQTIYFRDFRPL--------KDSRF-QLLNFSSSELKVSLTNVSISDEG 126
            ::.       .|.|.....|..||...|        .|.|| .:.|..:.:..:.:....:.|.|
  Fly    74 RIK-------NLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSG 131

Human   127 RYFCQLYTDPPQESYTTITVLVPP-------RNLMIDIQKDTAVEGEEIEVNCTAM-ASKPATTI 183
            .|.||:.|.|| ..||.:..:|.|       ..:.||:       |..:.:.|... ...|..::
  Fly   132 IYECQVSTTPP-VGYTMVFSVVEPITSILGGPEIYIDL-------GSTVNLTCVIKHLPDPPISV 188

Human   184 RWFKGNTELK------GKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVIC---------------Q 227
            :|...|.|:.      |.|.:.|..|:  .||.|:::.....|.....|               :
  Fly   189 QWNHNNQEINYDSPRGGVSVITEKGDI--TTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILK 251

Human   228 VEHPA 232
            .:|||
  Fly   252 GDHPA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM1XP_016872946.1 None
dpr21NP_001163838.2 Ig 71..149 CDD:299845 21/85 (25%)
IG_like 71..140 CDD:214653 16/75 (21%)
IG_like 162..249 CDD:214653 17/95 (18%)
IGc2 169..242 CDD:197706 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.