DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM1 and sns

DIOPT Version :9

Sequence 1:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:433 Identity:106/433 - (24%)
Similarity:162/433 - (37%) Gaps:117/433 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    32 VQRSAPIAMKASGHTSGDGQNLF---TKDVTVIEGEVATISCQVNKSDDSV-------------- 79
            |..|||:...|.       |..|   ..|:.|:||..|.:.|:|.....:|              
  Fly    59 VLASAPVPSHAQ-------QQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAV 116

Human    80 ------IQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQ 138
                  ..:|...:|.||                    .|::|  |.||:|:..|.||:  .|.:
  Fly   117 IPGFPRYSVLGDRKQGIY--------------------NLRIS--NASINDDADYQCQV--GPAR 157

Human   139 -----ESYTTITVLVPPRNLMI----DIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKG 194
                 .:...:||:.||.::.|    ...|....|.:::::.|....:|||..|.|::||.|.|.
  Fly   158 LNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKP 222

Human   195 KSE---VEE-WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQR--YLEVQYKPQVHI 253
            :..   ||| .:..:|.||.|.||...:||.....||..|.|::.::..:.  .|.|.|.|....
  Fly   223 EKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPY 287

Human   254 QMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSG---PNLFINNLNKTDN- 314
            ...|......|.|..:||.|.:.|...|..:.|.:...::......||   .|::.......|| 
  Fly   288 IEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNK 352

Human   315 GTYRCEASNIVGK--AHSDYMLYVYDPPT--TIPPPT----------TTTTTTT----------- 354
            ..:||||||::.:  ..::..|.|...||  |:..||          |.||..:           
  Fly   353 ARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVG 417

Human   355 ------TTTTTIL------TIITDTTATTEP-------AVHGL 378
                  .|:.||:      |..::.||..||       ..|||
  Fly   418 GRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM1XP_016872946.1 None
snsNP_001036532.1 I-set 73..170 CDD:254352 23/120 (19%)
Ig 76..155 CDD:299845 21/102 (21%)
IG_like 186..279 CDD:214653 28/92 (30%)
Ig 197..279 CDD:299845 26/81 (32%)
IG_like 296..376 CDD:214653 20/79 (25%)
Ig 300..361 CDD:299845 16/60 (27%)
Ig 380..454 CDD:299845 16/73 (22%)
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352
IGc2 692..757 CDD:197706
Ig 788..849 CDD:143165
Ig 885..960 CDD:143165
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11787
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.