DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CADM1 and dpr19

DIOPT Version :9

Sequence 1:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:435 Identity:82/435 - (18%)
Similarity:147/435 - (33%) Gaps:129/435 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    42 ASGHTSGDGQNLF-TKDVTVI---EGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPL---- 98
            :..|.....|:.| ||:.|.:   :|.:|.:.|.|..:..:.:..:..       :||:.|    
  Fly    30 SQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRR-------KDFQLLTVGL 87

Human    99 ----KDSRFQL-----LNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLM 154
                .|.||.:     :...|..:|.    |...|.|.|.|||             .:.|.::::
  Fly    88 STHSSDKRFLVEHTRHMGHWSLRIKA----VREEDRGFYECQL-------------SIYPTQSIV 135

Human   155 IDIQKDTAV----EGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKV 215
            |:::...||    ...|:.::.|       :|:|     .|.|.|...|..:.::......|  :
  Fly   136 IELKIVEAVAEISSAPELHIDET-------STLR-----LECKLKRATENPAFVFWYHDSKM--I 186

Human   216 HKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYP-------LQGLTREGDALELTC 273
            :.:..|..|:..:..    .|.|:.::  .:..|....:.|.|       |..|....||::...
  Fly   187 NYDSQGGFVVTSIGQ----SNPQSGQF--YRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPA 245

Human   274 EAIGKPQPVMVTWVRVDDEMPQHAVLSGPN---LFINNLNKTDNGTYRCEASNIVGKAHSDYMLY 335
            ..:....|.|.       :..|.|.|..|:   |.:..:|....|.|.|..||.           
  Fly   246 ANVPSSTPYMT-------QQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNA----------- 292

Human   336 VYDPPTTIPPPTTTTTTTTTTTTTILTIITDTTATTEPAVHGLTQLPNSAEELDSEDLSDSRAG- 399
               .|.:|               |:..:..:.||..:.|...:         ||:|...:...| 
  Fly   293 ---RPASI---------------TVHVLRGEKTAAMQHANRSI---------LDTETNGNGTFGL 330

Human   400 -EEGSIRAVDHAVIGGVVAVVVFAMLCLL---IILGRY--FARHK 438
             ..|.:.......:.|  .::.|:.|.||   ::..|:  .|.||
  Fly   331 ITLGGLNGTSGVTLAG--GILYFSGLFLLMGAVVFDRFSLAATHK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CADM1XP_016872946.1 None
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 19/100 (19%)
IGc2 55..125 CDD:197706 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.