DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SGK3 and S6k

DIOPT Version :9

Sequence 1:NP_001028750.1 Gene:SGK3 / 23678 HGNCID:10812 Length:496 Species:Homo sapiens
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:371 Identity:160/371 - (43%)
Similarity:230/371 - (61%) Gaps:20/371 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   132 EDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDG----KFYAVKV 192
            :|....:.:....:|:|   .|.....|.||:..||:|||.:|||... ||..|    |::|:||
  Fly    50 QDTEGQETIQLCEENVN---PGKIKLGPKDFELKKVLGKGGYGKVFQV-RKTAGRDANKYFAMKV 110

Human   193 LQK-KIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRER 256
            |:| .||.|:|:..|..||||: |:.|||||:|.|.|:|||..|||.:|::::|||||.||:||.
  Fly   111 LKKASIVTNQKDTAHTRAERNI-LEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREG 174

Human   257 SFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTF 321
            .|.|....||.:||..|||:||.:.|:||||||||||||:.|||.|||||||||.|.....|.||
  Fly   175 IFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTF 239

Human   322 CGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSL 386
            |||.||:|||::.:..:...||||.|||::::||.|:|||...:..:..:.||...|:|...::.
  Fly   240 CGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTP 304

Human   387 TAWSILEELLEKDRQNRLGA-KEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFD 450
            .|..::..|:::....|||: .||...:|.||||:.::|.|::.:::.||..|.:...||:..||
  Fly   305 EARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFD 369

Human   451 TAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPS--EDL 494
            |.||.: :|..   |.|.:.::.|   |:..|.||:|..||  ||:
  Fly   370 TRFTRQ-IPVD---SPDDTTLSES---ANLIFQGFTYVAPSILEDM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SGK3NP_001028750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 4/23 (17%)
STKc_SGK3 165..490 CDD:270755 149/330 (45%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 5/10 (50%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 148/329 (45%)
STKc_p70S6K 81..402 CDD:270736 149/329 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100157
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.