DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAAF11 and CG14185

DIOPT Version :9

Sequence 1:XP_006716601.2 Gene:DNAAF11 / 23639 HGNCID:16725 Length:472 Species:Homo sapiens
Sequence 2:NP_649175.1 Gene:CG14185 / 40197 FlyBaseID:FBgn0036936 Length:402 Species:Drosophila melanogaster


Alignment Length:175 Identity:48/175 - (27%)
Similarity:72/175 - (41%) Gaps:30/175 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    12 EDLIRRNAEHNDC---------VI---FSLEELSLHQQEIERLEHID------KWCRDLKILYLQ 58
            ::|:||..:..|.         ||   .||..|||.   :.||:.:|      ...|||....||
  Fly   107 DELLRRVTQRTDLEAVEQVRLRVISYTVSLSRLSLF---LPRLQSLDLSGSVLSSLRDLGYGLLQ 168

Human    59 -------NNLIGKIENVSKLKKLEYLNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQ 116
                   |..:...:..|.|..:..|....|.|::::.|.....|..|....|.|.||..:..|.
  Fly   169 LTRLDISNCGLNSFDGTSGLPAIRVLIADGNMIQRVDPLAELVHLRVLKARNNRISELGLLSFLG 233

Human   117 HNIHLKELFLMGNPCASFDHYREFVVATLPQLKWLDGKEI--EPS 159
            ....|:|:.|.|||......||..:..::|.|:.|||:.:  ||:
  Fly   234 MCPQLQEVELQGNPVCRLPLYRSLLARSVPTLQLLDGRVLNGEPA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAAF11XP_006716601.2 LRR_RI <5..200 CDD:238064 48/175 (27%)
leucine-rich repeat 29..51 CDD:275378 7/27 (26%)
LRR_8 52..104 CDD:290566 12/58 (21%)
LRR_4 52..92 CDD:289563 10/46 (22%)
leucine-rich repeat 52..73 CDD:275378 6/27 (22%)
leucine-rich repeat 74..95 CDD:275378 4/20 (20%)
leucine-rich repeat 96..120 CDD:275378 7/23 (30%)
LRRcap 134..152 CDD:197729 4/17 (24%)
CG14185NP_649175.1 LRR_8 144..201 CDD:290566 13/56 (23%)
leucine-rich repeat 146..168 CDD:275380 5/21 (24%)
LRR_4 168..209 CDD:289563 8/40 (20%)
leucine-rich repeat 169..190 CDD:275380 3/20 (15%)
leucine-rich repeat 191..212 CDD:275380 4/20 (20%)
leucine-rich repeat 213..237 CDD:275380 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.