DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAAF11 and CG8800

DIOPT Version :9

Sequence 1:XP_006716601.2 Gene:DNAAF11 / 23639 HGNCID:16725 Length:472 Species:Homo sapiens
Sequence 2:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster


Alignment Length:150 Identity:44/150 - (29%)
Similarity:74/150 - (49%) Gaps:16/150 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    30 EELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKL-KKLEYLNLALNNIEKIENLEGC 93
            |.:|:....||::..: ...:.||:|.|..|.|.:|..:..: :.||.|.|:.|.||||:.|.|.
  Fly    51 ERISMSTNMIEKIFGL-SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGL 114

Human    94 EELAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCA-SFDH--YREFVVATLPQLKWLDGKE 155
            :.|..|.::.|.|.:.|....|.....|::|.::|||.: ..|.  :|...:..||.::.|||:.
  Fly   115 KCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEP 179

Human   156 IEPSERIKALQDYSVIEPQI 175
            :..:|           |||:
  Fly   180 VVLNE-----------EPQL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAAF11XP_006716601.2 LRR_RI <5..200 CDD:238064 44/149 (30%)
leucine-rich repeat 29..51 CDD:275378 4/20 (20%)
LRR_8 52..104 CDD:290566 20/52 (38%)
LRR_4 52..92 CDD:289563 17/40 (43%)
leucine-rich repeat 52..73 CDD:275378 7/21 (33%)
leucine-rich repeat 74..95 CDD:275378 11/20 (55%)
leucine-rich repeat 96..120 CDD:275378 6/23 (26%)
LRRcap 134..152 CDD:197729 4/19 (21%)
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 40/129 (31%)
leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
leucine-rich repeat 95..116 CDD:275380 11/20 (55%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.