DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAAF11 and Cep97

DIOPT Version :9

Sequence 1:XP_006716601.2 Gene:DNAAF11 / 23639 HGNCID:16725 Length:472 Species:Homo sapiens
Sequence 2:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster


Alignment Length:241 Identity:66/241 - (27%)
Similarity:103/241 - (42%) Gaps:56/241 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    24 CVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKLKKLEYLNLALNNI---- 84
            |.:..|.||:|....|..:|.: |.|..|::|.|:.|.|..||:::....||.||||.|:|    
  Fly    71 CRLHCLRELNLSFNGILSIEGL-KECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSIS 134

Human    85 ---------------EKIENLEGCEE-----LAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGN 129
                           .::.:|..|::     |..|.|..|.|.:|:.|..|.|..:|..:.:..|
  Fly   135 DMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADN 199

Human   130 PCAS-------FDHYREFVVATLPQLKWLDGKEIEPSERIKALQDYS--------VIEPQ----- 174
            ||.:       || ||.||:.....||::||..::|.|.:||...||        |.|.|     
  Fly   200 PCVTMINSLDGFD-YRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKY 263

Human   175 ----------IREQEKDHCLKRAKLKEEAQRKHQEEDKNEDKRSNA 210
                      ..|.|.|..|:....|.:..::..:|:..::..|:|
  Fly   264 LSSVCPLVGKALENENDRKLRLILSKAQHHQRQLQEEIMDNANSSA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAAF11XP_006716601.2 LRR_RI <5..200 CDD:238064 63/229 (28%)
leucine-rich repeat 29..51 CDD:275378 8/21 (38%)
LRR_8 52..104 CDD:290566 20/75 (27%)
LRR_4 52..92 CDD:289563 16/58 (28%)
leucine-rich repeat 52..73 CDD:275378 7/20 (35%)
leucine-rich repeat 74..95 CDD:275378 10/39 (26%)
leucine-rich repeat 96..120 CDD:275378 9/23 (39%)
LRRcap 134..152 CDD:197729 8/17 (47%)
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380
leucine-rich repeat 32..53 CDD:275380
LRR_RI <49..189 CDD:238064 35/118 (30%)
LRR_4 76..115 CDD:289563 15/39 (38%)
leucine-rich repeat 76..97 CDD:275380 8/21 (38%)
LRR_8 97..152 CDD:290566 15/54 (28%)
LRR_4 97..137 CDD:289563 15/39 (38%)
leucine-rich repeat 98..119 CDD:275380 7/20 (35%)
leucine-rich repeat 120..141 CDD:275380 8/20 (40%)
LRR_8 140..200 CDD:290566 12/59 (20%)
leucine-rich repeat 142..165 CDD:275380 2/22 (9%)
leucine-rich repeat 166..190 CDD:275380 9/23 (39%)
IQ 581..599 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.