DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CA14 and CAH1

DIOPT Version :9

Sequence 1:NP_036245.1 Gene:CA14 / 23632 HGNCID:1372 Length:337 Species:Homo sapiens
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:263 Identity:86/263 - (32%)
Similarity:133/263 - (50%) Gaps:15/263 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    21 HWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHT 85
            ||.|...:|..||...||:...:.|||:||...|.....:| .:.|..:.........|.|.|:.
  Fly     4 HWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSEL-NVAPLKWKYVPEHTKSLVNPGYC 67

Human    86 VQLSL---PSTLYLGGL-PRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDS 146
            .::.:   .|.|..|.| .:.:...|.|.|||...|. ||||.::..:...|||:||:::..|.|
  Fly    68 WRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSK-GSEHTVDGVSYSGELHLVHWNTTKYKS 131

Human   147 LSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPP-FNLRELLPKQLGQYF 210
            ..|||..|.||||||:.::.| ..:...:.:.|.|..|.||..:.::|. .:..:||| .:..|:
  Fly   132 FGEAAAAPDGLAVLGVFLKAG-NHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLP-DVHTYW 194

Human   211 RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQG-TLFSTEEE-P----SKLLVQNYRALQPL 269
            .|.||||||||.:||:|.||....::|.:||..::. ..:..:|| |    :..::.|:|...||
  Fly   195 TYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPL 259

Human   270 NQR 272
            .:|
  Fly   260 GKR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CA14NP_036245.1 alpha_CA_XII_XIV 29..278 CDD:239400 83/255 (33%)
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 85/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.