DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and cathD

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster


Alignment Length:408 Identity:107/408 - (26%)
Similarity:167/408 - (40%) Gaps:84/408 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    52 EEPG-----------RRGSFVEM---VDNLRGKSGQG-------------YYVEMTVGSPPQTLN 89
            |:||           .|..|.::   :..||.:.|.|             ||..:.:|||||...
  Fly    23 EKPGLLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFR 87

Human    90 ILVDTGSSNFAVGAAP-H-----PFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSI 148
            ::.||||||..|.:.. |     ..:|..|....|.||........:.|..|...|.|.||.|||
  Fly    88 VVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSI 152

Human   149 PHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSL 213
            . |.::..:....|::|....|: .:.::|||||.|..|:  .|.::|.|.::.:|    .|.|.
  Fly   153 A-GLDIKDQTFAEALSEPGLVFV-AAKFDGILGLGYNSIS--VDKVKPPFYAMYEQ----GLISA 209

Human   214 QLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDC 278
            .:  ..|.||: :..:..||.:|.||.|.:.|||...|.|:.|:.|:::.:....|.  ||:: |
  Fly   210 PV--FSFYLNR-DPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASIG--DLQL-C 268

Human   279 KEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPV 343
            |  ...:.|.|:||:.:..|.:         :|.|..:|......:|.|.|. .....|.  .||
  Fly   269 K--GGCQVIADTGTSLIAAPLE---------EATSINQKIGGTPIIGGQYVV-SCDLIPQ--LPV 319

Human   344 ISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGT----------VMGAVI 398
            |...|.|    ::|.:.  .:.|:..|..:.       |........|.          ::|.|.
  Fly   320 IKFVLGG----KTFELE--GKDYILRVAQMG-------KTICLSGFMGLDIPPPNGPLWILGDVF 371

Human   399 MEGFYVVFDRARKRIGFA 416
            :..:|..||....|:|||
  Fly   372 IGKYYTEFDMGNDRVGFA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 3/16 (19%)
beta_secretase_like 72..437 CDD:133140 100/374 (27%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
cathDNP_001334713.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.