DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and CG5863

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster


Alignment Length:459 Identity:113/459 - (24%)
Similarity:184/459 - (40%) Gaps:117/459 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     7 WLLLWM-------GAGVLPAHGTQHGIRLPL-------------RSG----------LGGAPLGL 41
            ||.||:       ..|.|        ||:|:             |:|          :||     
  Fly     8 WLSLWILCLFWAKCQGQL--------IRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGG----- 59

Human    42 RLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAP- 105
                     .|...|.|...|.:||   :....|...:::|||.|..|:|.||||:|..|.:|. 
  Fly    60 ---------QEVTSRNGGATETLDN---RLNLEYAGPISIGSPGQPFNMLFDTGSANLWVPSAEC 112

Human   106 --------HPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAA 162
                    |   |..|....|||:....:...:.|..|...|.|..|.|:|  |..|........
  Fly   113 SPKSVACHH---HHRYNASASSTFVPDGRRFSIAYGTGSLSGRLAQDTVAI--GQLVVQNQTFGM 172

Human   163 IT-ESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQS 225
            .| |....|:: :|:.||:||.:..||  :..::|.|:|:..|..|.. :||..|     ..|.|
  Fly   173 ATHEPGPTFVD-TNFAGIVGLGFRPIA--ELGIKPLFESMCDQQLVDECVFSFYL-----KRNGS 229

Human   226 EVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDS 290
            |   ..||.::.||:|.:.::|||.|.|:....|::..:..:|:.|..:..:      .::|.|:
  Fly   230 E---RKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAGTRINQN------RQAIADT 285

Human   291 GTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLV-CWQAGTTPWNIFPVISLYLMGEVTN 354
            ||:.|..|.:.: ..:.|:.....|..       .|.|: |.:..:.|..:|      ::|    
  Fly   286 GTSLLAAPPREY-LIINSLLGGLPTSN-------NEYLLNCSEIDSLPEIVF------IIG---- 332

Human   355 QSFRITILPQQYLRPVEDVATSQDD----CYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGF 415
             ..|..:.|:.|:     ::.:.||    |........:...::|.|.:..:|..||..::||||
  Fly   333 -GQRFGLQPRDYV-----MSATNDDGSSICLSAFTLMDAEFWILGDVFIGRYYTAFDAGQRRIGF 391

Human   416 AVSA 419
            |.:|
  Fly   392 APAA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 2/18 (11%)
beta_secretase_like 72..437 CDD:133140 94/364 (26%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 94/369 (25%)
Asp 80..394 CDD:278455 93/359 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.