DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and CG5860

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster


Alignment Length:457 Identity:99/457 - (21%)
Similarity:172/457 - (37%) Gaps:131/457 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAQALPWLLLWMGAGVLPAHGTQHGIRLPL--------------RSGL-GGAPLGLRLPRETDEE 50
            |.:.|.:||.::..    ...||..:::||              ||.. ||..|.|:|..:|...
  Fly     1 MLRVLCFLLAFLSL----VFATQKILKVPLYVRRSFNESEVFLARSATEGGETLQLQLLLQTHNN 61

Human    51 PEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFL------ 109
            .|                      ||..:.:|:|.|...::.||||||..:.:...|..      
  Fly    62 ME----------------------YYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQN 104

Human   110 HRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFI--- 171
            ||.|....||:|....:...:.|..|...|.|..|.:.|       ..|.:...|..:..|:   
  Fly   105 HRKYNSSRSSSYIPDGRNFTLRYGSGMVVGYLSKDTMHI-------AGAELPHFTFGESLFLQHF 162

Human   172 --NGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGS 234
              :...::|::||....::..:.:  ||.:.|..|.      .|:.|.....|.:..      ..
  Fly   163 AFSSVKFDGLVGLGLGVLSWSNTT--PFLELLCAQR------LLEKCVFSVYLRRDP------RE 213

Human   235 MIIGGIDHSLYTGSLWYTPIRR--EWYYEVIIVRV---EINGQDLKMDCKEYNYDKSIVDSGTTN 294
            ::.||.|.|.:.|.|.|.|:.:  .|..::....|   :|.|:           ..:|:|:||:.
  Fly   214 IVFGGFDESKFEGKLHYVPVSQWHTWSLQISKSSVGTKQIGGK-----------SNAILDTGTSL 267

Human   295 LRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNI--------FPVISL-YLMG 350
            :.:|::.:...:.::.|     |..:|::    :|..::|:.| ||        ||:.|. |:| 
  Fly   268 VLVPQQTYHNLLNTLSA-----KLQNGYF----VVACKSGSLP-NINILIGDKVFPLTSSDYIM- 321

Human   351 EVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTG-TVMGAVIMEGFYVVFDRARKRIG 414
                                 :|...:......||:..:.| .|:|.:.:..:|.|||...||||
  Fly   322 ---------------------EVLLDRKPACVLAIAPINRGFWVLGDIFLRRYYTVFDATEKRIG 365

Human   415 FA 416
            .|
  Fly   366 LA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 5/18 (28%)
beta_secretase_like 72..437 CDD:133140 82/371 (22%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 83/393 (21%)
Asp 63..369 CDD:278455 83/391 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.