DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and CG17283

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_650621.1 Gene:CG17283 / 42094 FlyBaseID:FBgn0038505 Length:465 Species:Drosophila melanogaster


Alignment Length:399 Identity:100/399 - (25%)
Similarity:155/399 - (38%) Gaps:86/399 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    59 SFVEMVDNLRGK---------------SGQG---------YYVEMTVGSPPQTLNILVDTGSSNF 99
            :||...||||.:               ||..         |..:|.:|:|.|...:|.||||||.
  Fly   110 NFVRTTDNLRSEKAFLANRYGFSFAKSSGTATLKNTANMEYTCKMNIGTPKQKFTVLPDTGSSNI 174

Human   100 AVGAAPHPFL-------HRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVR 157
            .|   |.|..       |:.|....||||....|...:.|..|...|.|..|.|.|. |..||.:
  Fly   175 WV---PGPHCKSKACKKHKQYHPAKSSTYVKNGKSFAITYGSGSVAGVLAKDTVRIA-GLVVTNQ 235

Human   158 ANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNL-FSLQLCGAGFP 221
            .......|....|:. ||::|||||.|..||  .|:::....::..:..:.:. |::.:.|.|  
  Fly   236 TFAMTTKEPGTTFVT-SNFDGILGLGYRSIA--VDNVKTLVQNMCSEDVITSCKFAICMKGGG-- 295

Human   222 LNQSEVLASVGGSMIIGGIDHSLYTG--SLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYD 284
                  .:|.||::|.|..:.|.|:|  |..|||:.::.|::..:..:.:.|      .|.....
  Fly   296 ------SSSRGGAIIFGSSNTSAYSGSNSYTYTPVTKKGYWQFTLQDIYVGG------TKVSGSV 348

Human   285 KSIVDSGTTNLRLPKKVFEAAVKSI--KAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLY 347
            ::||||||:.:..|..::....|.|  :|.||.|             ||......   .|..:..
  Fly   349 QAIVDSGTSLITAPTAIYNKINKVIGCRATSSGE-------------CWMKCAKK---IPDFTFV 397

Human   348 LMGE---VTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRA 409
            :.|:   |.....::.:...:          .:..|............::|...:..|...||.|
  Fly   398 IAGKKFVVKGNKMKLKVRTNR----------GRTVCISAVTEVPDEPVILGDAFIRHFCTEFDLA 452

Human   410 RKRIGFAVS 418
            ..|||||.:
  Fly   453 NNRIGFAAT 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58
beta_secretase_like 72..437 CDD:133140 93/371 (25%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
CG17283NP_650621.1 pepsin_retropepsin_like 142..459 CDD:299705 90/363 (25%)
Asp 149..460 CDD:278455 91/357 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.