DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and Bace

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_001285756.1 Gene:Bace / 34182 FlyBaseID:FBgn0032049 Length:372 Species:Drosophila melanogaster


Alignment Length:389 Identity:101/389 - (25%)
Similarity:156/389 - (40%) Gaps:82/389 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    42 RLP--RETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGA- 103
            :||  |..|||               .|.......||..:::|:|.|:..:|.|:||||..|.: 
  Fly    49 QLPSLRSVDEE---------------QLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSN 98

Human   104 ---APHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITE 165
               :.....|..|....||||....:...:.|..|...|.|.||.|.: :|.::..:....:..|
  Fly    99 TCKSDACLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDTVDV-NGLSIQSQTFAESTNE 162

Human   166 SDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQSEVLA 229
            ....| |.:|::||||:||..:|  .|.:.|.|.::|.|..|.| :||..|...|        .:
  Fly   163 PGTNF-NDANFDGILGMAYESLA--VDGVAPPFYNMVSQGLVDNSVFSFYLARDG--------TS 216

Human   230 SVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTN 294
            ::||.:|.||.|.|||:|:|.|.||..:.|::..:....|:|..|..||      ::|.|:||:.
  Fly   217 TMGGELIFGGSDASLYSGALTYVPISEQGYWQFTMAGSSIDGYSLCDDC------QAIADTGTSL 275

Human   295 LRLP-------KKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEV 352
            :..|       .::...........||....||        |.:..|.|.:              
  Fly   276 IVAPYNAYITLSEILNVGEDGYLDCSSVSSLPD--------VTFNIGGTNF-------------- 318

Human   353 TNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFA 416
                         .|:|...:..|..:|........:...::|.|.:..:|..||....|||||
  Fly   319 -------------VLKPSAYIIQSDGNCMSAFEYMGTDFWILGDVFIGQYYTEFDLGNNRIGFA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 6/17 (35%)
beta_secretase_like 72..437 CDD:133140 94/357 (26%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
BaceNP_001285756.1 pepsin_retropepsin_like 59..369 CDD:299705 94/377 (25%)
Asp 68..371 CDD:278455 94/355 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.