DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and CG33128

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_787961.1 Gene:CG33128 / 326263 FlyBaseID:FBgn0053128 Length:405 Species:Drosophila melanogaster


Alignment Length:404 Identity:96/404 - (23%)
Similarity:165/404 - (40%) Gaps:77/404 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    36 GAPL------GLRLPRET--DEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILV 92
            |.|:      |...|.:|  |...||.|             ......||..:.:|:|.|...::.
  Fly    59 GVPIYMQPDYGYDYPSQTSVDYTSEELG-------------NSMNMYYYGLIGIGTPEQYFKVVF 110

Human    93 DTGSSNFAVGAAPHPFL------HRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHG 151
            ||||:|..|.:|.....      |..|....|||:....:...:.|..|...|.|..|.|:| :|
  Fly   111 DTGSANLWVPSAQCLATDVACQQHNQYNSSASSTFVSSGQNFSIQYGTGSVSGYLAIDTVTI-NG 174

Human   152 PNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPN-LFSLQL 215
            ..:..:....|:::....|.:.: ::||||:.|.:||  :|::.|.|.:|.::..:.. :|...|
  Fly   175 LAIANQTFGEAVSQPGASFTDVA-FDGILGMGYQQIA--EDNVVPPFYNLYEEGLIDEPVFGFYL 236

Human   216 CGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE 280
            ...|..::        ||.:.:||.|.:|..|.:.|||:.::.|::..:..:..||..:...|  
  Fly   237 ARNGSAVD--------GGQLTLGGTDQNLIAGEMTYTPVTQQGYWQFAVNNITWNGTVISSGC-- 291

Human   281 YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLV-CWQAGTTPWNIFPVI 344
                ::|.|:||:.:..|...:......|......         |:..| |....:     .||:
  Fly   292 ----QAIADTGTSLIAAPSAAYIQLNNLIGGVPIQ---------GDYYVPCSTVSS-----LPVL 338

Human   345 SLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQ-SSTGT---VMGAVIMEGFYVV 405
            ::.:.|  ||          .||.|...:.|..:..|...:|. :..||   ::|.|.:..:|..
  Fly   339 TINIGG--TN----------FYLPPSVYIQTYTEGNYTTCMSTFTDIGTGFWILGDVFLGQYYSE 391

Human   406 FDRARKRIGFAVSA 419
            ||..:.|:|||..|
  Fly   392 FDFGQNRVGFATLA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 7/26 (27%)
beta_secretase_like 72..437 CDD:133140 87/360 (24%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
CG33128NP_787961.1 pepsin_retropepsin_like 83..403 CDD:299705 88/376 (23%)
Asp 92..404 CDD:278455 86/355 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.