DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and CG31928

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_001259869.1 Gene:CG31928 / 326175 FlyBaseID:FBgn0051928 Length:418 Species:Drosophila melanogaster


Alignment Length:371 Identity:92/371 - (24%)
Similarity:159/371 - (42%) Gaps:56/371 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    65 DNLRGKSGQGYYVEMTVGSP-PQTLNILVDTGSSNFAVGAAP-------HPFLHRYYQRQLSSTY 121
            :||.......|||....|:| .|.:.:||||.|:|..|.::.       |   |..|....|.||
  Fly    82 ENLINSHNTEYYVTAGFGTPKSQPVTLLVDTASANLLVYSSEFVKQSCLH---HDGYNSSESQTY 143

Human   122 RDLRKGVYVPY-TQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYA 185
            :.......:.: :|....|.|.||..::  |..|......|.|..:.......||::||:||.::
  Fly   144 QANGSPFQIQFASQEILTGILSTDTFTL--GDLVIKNQTFAEINSAPTDMCKRSNFDGIIGLGFS 206

Human   186 EIARPDDSLEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSL 249
            |||.  :.:|...|::::|..:.. :|||.       :|::...||.||.:::||.|.:||:|.|
  Fly   207 EIAL--NGVETPLDNILEQGLIDEPIFSLY-------VNRNASDASNGGVLLLGGSDPTLYSGCL 262

Human   250 WYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASS 314
            .|.|:.:..::::.:.:|||..:.|..:|      ::|.|.||:.:.:|....:...|.:....:
  Fly   263 TYVPVSKVGFWQITVGQVEIGSKKLCSNC------QAIFDMGTSLIIVPCPALKIINKKLGIKET 321

Human   315 TEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFR-ITILPQQYLRPVEDVA---- 374
            ..|  ||.::   :.|.:....|..:|            |..:: .|:.|..|:.......    
  Fly   322 DRK--DGVYI---IDCKKVSHLPKIVF------------NIGWKDFTLNPSDYILNYSGTCVSGF 369

Human   375 TSQDDCYKFAISQSSTGT----VMGAVIMEGFYVVFDRARKRIGFA 416
            :|..||.....:..|...    |.|.|.....:.:||...|.:|.|
  Fly   370 SSLSDCNGTQTNDDSEDLNNIWVFGDVFFGAIFTLFDFGLKLVGMA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58
beta_secretase_like 72..437 CDD:133140 90/364 (25%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
CG31928NP_001259869.1 pepsin_retropepsin_like 84..416 CDD:299705 91/369 (25%)
Asp 91..416 CDD:278455 90/362 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4239
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.