DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BACE1 and Pgcl

DIOPT Version :9

Sequence 1:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens
Sequence 2:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster


Alignment Length:368 Identity:87/368 - (23%)
Similarity:153/368 - (41%) Gaps:79/368 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    65 DNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNF------AVGAAPHPFLHRYYQRQLSSTYRD 123
            ||.:      ||..:::|:|.|...:..||||||.      .:..|...  |:.:.:..||||..
  Fly    73 DNFQ------YYGNISIGTPGQDFLVQFDTGSSNLWVPGSSCISTACQD--HQVFYKNKSSTYVA 129

Human   124 LRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANI--AAITESDKFFINGSNWEGILGLAYAE 186
            ......:.|..|...|.|..|.|..   ..:|:::..  ...||....|:: :.::||||:.:..
  Fly   130 NGTAFSITYGTGSVSGYLSVDCVGF---AGLTIQSQTFGEVTTEQGTNFVD-AYFDGILGMGFPS 190

Human   187 IARPDDSLEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLW 250
            :|  .|.:.|.|.::::|..|.: :||       |.|..:..:...||.:|:||.|.|||:|||.
  Fly   191 LA--VDGVTPTFQNMMQQGLVQSPVFS-------FFLRDNGSVTFYGGELILGGSDPSLYSGSLT 246

Human   251 YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPK-------KVFEAAVKS 308
            |..:.:..|::.....:::....:.      .:.::|.|:||:.:..|:       ::|.|..:.
  Fly   247 YVNVVQAAYWKFQTDYIKVGSTSIS------TFAQAIADTGTSLIIAPQAQYDQISQLFNANSEG 305

Human   309 IKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDV 373
            :...||| .:||                           |:..:....|:|   |.:|.     :
  Fly   306 LFECSST-SYPD---------------------------LIININGVDFKI---PAKYY-----I 334

Human   374 ATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFA 416
            ...:|.|.....|.:....:||.|.:...|..||...:|:|||
  Fly   335 IEEEDFCSLAIQSINQDFWIMGDVFLGRIYTEFDVGNQRLGFA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58
beta_secretase_like 72..437 CDD:133140 85/361 (24%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
PgclNP_525030.1 pepsin_retropepsin_like 67..378 CDD:299705 87/368 (24%)
Asp 76..379 CDD:278455 85/365 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.