DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSSK2 and PTK1

DIOPT Version :9

Sequence 1:NP_443732.3 Gene:TSSK2 / 23617 HGNCID:11401 Length:358 Species:Homo sapiens
Sequence 2:NP_012723.3 Gene:PTK1 / 853635 SGDID:S000001681 Length:662 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:86/315 - (27%)
Similarity:135/315 - (42%) Gaps:76/315 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    19 GKGSYAKVKSAYSERLKFNVAVKIIDR--KKTPTDFVERFLPREMDILATVNHGSIIKTYEIFET 81
            |.....|::|.|.::..|  |:|.::.  .:||..|.:| ..:|..|...::|...|....:...
Yeast   206 GSCEVRKIRSKYRKKDVF--ALKKLNMIYNETPEKFYKR-CSKEFIIAKQLSHHVHITNTFLLVK 267

Human    82 SDGRIY------IIMELGVQGDLLEFIKCQGALHEDVARK--MFRQLSSAVKYCHDLDIVHRDLK 138
            ....:|      .:||||:: ||...|:..|.....:|.|  :|:|::..||:|||..|.|||||
Yeast   268 VPTTVYTTRGWGFVMELGLR-DLFAMIQKSGWRSVALAEKFCIFKQVACGVKFCHDQGIAHRDLK 331

Human   139 CENLLLDKDFNIKLSDFGFS--------------KRCLRDSNGRIILSKTFCGSAAYAAPEV--- 186
            .||:||..|...||:|||.|              |:|.    |.|       ||..||.|||   
Yeast   332 PENVLLSPDGVCKLTDFGISDWYHTDPHDLSSPVKKCA----GMI-------GSPPYAPPEVMFY 385

Human   187 ---------LQSIPYQPKVYDIWSLGVILYIMVCGSMPYDDS----------------DIR---K 223
                     ||. ||.|:..|.:.||:||..:|...:|:.:|                .||   :
Yeast   386 DSKKHYDTELQQ-PYDPRALDCYGLGIILMTLVNNVIPFLESCSFDTGFRDYCDAYENFIRLHDR 449

Human   224 MLRIQKEHR----VDFPRSKNL-TCECKDLIYRMLQPDVSQRLHIDEILSHSWLQ 273
            ..|.:..:|    :::..::|. ......:.:|:..|:.:.|..||::....|.|
Yeast   450 AFRNRGNYRPGPGMEYHLARNFKNGHASRVAWRLADPEAATRYTIDDLFEDPWFQ 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSSK2NP_443732.3 STKc_TSSK1_2-like 10..272 CDD:271067 84/312 (27%)
S_TKc 12..272 CDD:214567 84/312 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..358
PTK1NP_012723.3 PKc_like 202..503 CDD:419665 84/312 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C159049843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.