DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZMYND8 and png2

DIOPT Version :9

Sequence 1:NP_001350643.1 Gene:ZMYND8 / 23613 HGNCID:9397 Length:1241 Species:Homo sapiens
Sequence 2:NP_001342766.1 Gene:png2 / 2539953 PomBaseID:SPBC1709.11c Length:305 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:42/133 - (31%)
Similarity:61/133 - (45%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    37 PGSAERTAQKRKFPSPPHSSNGHSPQDTSTSPIKKKKKPGLLNSNNKEQSELRHGPFYYMKQPL- 100
            |....:.|..||..|||.||..|:||.|...|:::.:  ..|...|.|              || 
pombe   184 PTKRRKNAVPRKSSSPPLSSTKHAPQSTERRPVRRSE--SRLKQTNGE--------------PLV 232

Human   101 ---TTDPVDVVPQDGRNDFYCWVCHR--EGQVLCC--ELCPRV-YHAKCLRLTSEPEGDWFCPEC 157
               |.|..| :.::| ...||: |.:  .||::.|  |.|.|. :|..|:.|...|:|.|:|.||
pombe   233 KHDTLDSSD-ISREG-EQLYCY-CQQVSYGQMIGCDNENCKREWFHLPCVGLVEPPKGIWYCKEC 294

Human   158 EKI 160
            |::
pombe   295 EEL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZMYND8NP_001350643.1 ING <31..160 CDD:331088 42/131 (32%)
PHD_PRKCBP1 117..157 CDD:277013 16/44 (36%)
Bromo_RACK7 178..276 CDD:99940
BS69_related 296..376 CDD:99902
DUF3544 445..647 CDD:314873
MIP-T3 <634..>795 CDD:313469
DUF1640 960..>1051 CDD:311647
zf-MYND 1055..1089 CDD:307734
png2NP_001342766.1 TNG2 6..298 CDD:227367 42/133 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.