DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK2 and CaMKI

DIOPT Version :9

Sequence 1:NP_001350659.1 Gene:DAPK2 / 23604 HGNCID:2675 Length:488 Species:Homo sapiens
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:345 Identity:117/345 - (33%)
Similarity:181/345 - (52%) Gaps:40/345 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    15 KQQKVEDFYDIGEELGSGQFAIVKKCREK-STGLEYAAKFIKKRQSRASRRGVSREEIEREVSIL 78
            ||..:|:.|::...||:|.|:.|:....| |.|..:|.|.|.|:..:.     ..|.:|.|:.:|
  Fly    23 KQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG-----KEESLENEIRVL 82

Human    79 R---------------QVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATS 128
            |               ::.|.|::.|.:.||:::.|.|::|||:||||||.:.:|.|.:|::|:.
  Fly    83 RRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASH 147

Human   129 FIKQILDGVNYLHTKKIAHFDLKPENIMLL----DKNIPIPHIKLIDFGLAHEIEDGVEFKNIFG 189
            .|:|||:.|:|:|.:.:.|.||||||::..    |..|.|.     ||||: ::||........|
  Fly   148 LIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMIS-----DFGLS-KMEDSGIMATACG 206

Human   190 TPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQT 254
            ||.:||||::..:|.|...|:||||||:||||.|..||..:......|.|....::||..::.:.
  Fly   207 TPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEI 271

Human   255 SELAKDFIRKLLVKETRKRLTIQEALRHPWITSKG------EGRAPEQRKTE--PTQLKTKHLRE 311
            ||.||.||:.|:.....||.|.::||.|.||:...      .|...||.|..  .::.|..:...
  Fly   272 SESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAA 336

Human   312 YTLKCHSSMPPN-NSYVNFE 330
            ..::....|..| ||..||:
  Fly   337 TVIRQMQRMALNSNSNANFD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK2NP_001350659.1 STKc_DAPK2 17..285 CDD:271098 102/287 (36%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 102/284 (36%)
S_TKc 31..302 CDD:214567 101/281 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.