DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DAPK2 and Mekk1

DIOPT Version :9

Sequence 1:NP_001350659.1 Gene:DAPK2 / 23604 HGNCID:2675 Length:488 Species:Homo sapiens
Sequence 2:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster


Alignment Length:301 Identity:81/301 - (26%)
Similarity:130/301 - (43%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     5 SMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSR- 68
            |:.|.:....:.:.|...:..|.::|.|:|..|......:||...|.|.|      |.:.|.:| 
  Fly  1264 SLNSSDKVHIRARSVHFRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEI------AIQPGETRA 1322

Human    69 -EEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQ 132
             :.:..|:.||..:.|.|::..:.:..:|.::::.:||.|.|.|...:....:|.|.....|..|
  Fly  1323 LKNVAEELKILEGIKHKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQ 1387

Human   133 ILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGV----EFKNIFGTPEF 193
            :|.||:.||...|.|.|:|..||.|:|.:   ..:||.|||.|.:|:...    |.:...||..:
  Fly  1388 LLSGVSELHKHGIVHRDIKTANIFLVDGS---NSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAY 1449

Human   194 VAPEI---VNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFF---- 251
            :|||:   .|.:..|..||:||:|.:...:.||..|:.                .||..|.    
  Fly  1450 MAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWA----------------QFDSNFQIMFK 1498

Human   252 ----------SQTSELAKDFIRKLLVKETRKRLTIQEALRH 282
                      ...|:...|||...|..:.::|||..|.|.|
  Fly  1499 VGMGEKPQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEH 1539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DAPK2NP_001350659.1 STKc_DAPK2 17..285 CDD:271098 79/289 (27%)
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 78/284 (27%)
S_TKc 1282..1541 CDD:214567 78/283 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.