DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARHSP1 and lin-28

DIOPT Version :9

Sequence 1:XP_005255285.3 Gene:CARHSP1 / 23589 HGNCID:17150 Length:168 Species:Homo sapiens
Sequence 2:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster


Alignment Length:75 Identity:28/75 - (37%)
Similarity:38/75 - (50%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    67 RRTRTFSATVRASQ----------GPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVE---- 117
            |||.:.|:|..|:.          |.|..|.||.|..:||.||:||.|||.::|:|.|.::    
  Fly    12 RRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGF 76

Human   118 ---GEYVPVE 124
               ||...||
  Fly    77 RSLGEQEEVE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARHSP1XP_005255285.3 None
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.