DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARHSP1 and lin-28

DIOPT Version :10

Sequence 1:NP_055131.2 Gene:CARHSP1 / 23589 HGNCID:17150 Length:147 Species:Homo sapiens
Sequence 2:NP_647983.1 Gene:lin-28 / 38639 FlyBaseID:FBgn0035626 Length:195 Species:Drosophila melanogaster


Alignment Length:75 Identity:28/75 - (37%)
Similarity:38/75 - (50%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    46 RRTRTFSATVRASQ----------GPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVE---- 96
            |||.:.|:|..|:.          |.|..|.||.|..:||.||:||.|||.::|:|.|.::    
  Fly    12 RRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGF 76

Human    97 ---GEYVPVE 103
               ||...||
  Fly    77 RSLGEQEEVE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARHSP1NP_055131.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 3/5 (60%)
CSP_CDS 63..128 CDD:239905 20/48 (42%)
lin-28NP_647983.1 CSP_CDS 41..101 CDD:239905 20/46 (43%)

Return to query results.
Submit another query.