| Sequence 1: | NP_055127.2 | Gene: | VSIG2 / 23584 | HGNCID: | 17149 | Length: | 327 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
| Alignment Length: | 268 | Identity: | 63/268 - (23%) |
|---|---|---|---|
| Similarity: | 99/268 - (36%) | Gaps: | 49/268 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Human 5 PGPFLCGALLGFLCLSGLAVEVKV-------PTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFV 62
Human 63 QPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPP 127
Human 128 DFYTNGLGLINLTVLVPPSNPLCSQSGQTSV----GGSTALRCSSSEGAPKPVYNWVRLGTFPTP 188
Human 189 SPGSMVQDEVSGQLI--------LTNLSLTSSGTYRCVATNQM-GSASCELTLSVTEPSQGRVAG 244
Human 245 ALIGVLLG 252 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| VSIG2 | NP_055127.2 | V-set | 31..142 | CDD:311561 | 24/110 (22%) |
| Ig | 164..231 | CDD:319273 | 19/75 (25%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..327 | ||||
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 25/111 (23%) |
| Ig | 145..238 | CDD:416386 | 26/101 (26%) | ||
| Ig strand A | 145..149 | CDD:409353 | 2/4 (50%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
| Ig | 242..333 | CDD:416386 | 4/15 (27%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 1/2 (50%) | ||
| Ig strand B | 259..266 | CDD:409353 | |||
| Ig strand C | 272..277 | CDD:409353 | |||
| Ig strand C' | 281..283 | CDD:409353 | |||
| Ig strand D | 289..293 | CDD:409353 | |||
| Ig strand E | 295..305 | CDD:409353 | |||
| Ig strand F | 314..322 | CDD:409353 | |||
| Ig strand G | 325..334 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||